• Gene id: 58494

Gene Summary

• Gene Symbol: JAM2   Gene   UCSC   Ensembl
• Aliases: C21orf43, CD322, IBGC8, JAM-B, JAMB, PRO245, VE-JAM, VEJAM
• Gene name: junctional adhesion molecule 2
• Alternate names: junctional adhesion molecule B, JAM-2, JAM-IT/VE-JAM, vascular endothelial junction-associated molecule,
• Gene location: 21q21.3 (25607549: 25717561)     Exons: 14     NC_000021.9
• Gene summary(Entrez): This gene belongs to the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. The protein encoded by this gene is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. It act
• OMIM: 603440

Protein Summary

• Protein general information: P57087  
  • Name: Junctional adhesion molecule B (JAM B) (Junctional adhesion molecule 2) (JAM 2) (Vascular endothelial junction associated molecule) (VE JAM) (CD antigen CD322)
  • Length: 298  
  • Mass: 33207
  • Tissue specificity: Highly expressed in heart, placenta, lung, foreskin and lymph node (PubMed
• Sequence:

  MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYY
  QQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTV
  VELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRC
  PGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII

• Structural information:
  • Protein Domains: (32..12-)
    (/note="Ig-like-V-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00114-)
    (134..23-)
    (/note="Ig-like-C2-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  IPR042625  
  • Prosite: PS50835
  • STRING: ENSP00000383376
• Other Databases: GeneCards:  JAM2  Malacards:  JAM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000403	positive regulation of lymphocyte migration	IDA	biological process
GO:0044291	cell-cell contact zone	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0071593	lymphocyte aggregation	IDA	biological process
GO:0050901	leukocyte tethering or rolling	IDA	biological process
GO:0035633	maintenance of blood-brain barrier	NAS	biological process
GO:0098636	protein complex involved in cell adhesion	IDA	cellular component
GO:0045123	cellular extravasation	IDA	biological process
GO:0005178	integrin binding	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0070160	tight junction	ISS	cellular component
GO:0036477	somatodendritic compartment	ISS	cellular component
GO:0031642	negative regulation of myelination	ISS	biological process
GO:0007286	spermatid development	ISS	biological process
GO:0098609	cell-cell adhesion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007520	myoblast fusion	ISS	biological process
GO:0097241	hematopoietic stem cell migration to bone marrow	IMP	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0097241	hematopoietic stem cell migration to bone marrow	IEA	biological process
GO:0050901	leukocyte tethering or rolling	IEA	biological process
GO:0045123	cellular extravasation	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0007162	negative regulation of cell adhesion	IEA	biological process
GO:2000403	positive regulation of lymphocyte migration	IEA	biological process
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0070160	tight junction	IEA	cellular component
GO:0036477	somatodendritic compartment	IEA	cellular component
GO:0031642	negative regulation of myelination	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098609	cell-cell adhesion	NAS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction
hsa04514	Cell adhesion molecules
hsa04670	Leukocyte transendothelial migration
hsa05120	Epithelial cell signaling in Helicobacter pylori infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881