• Gene id: 5834

Gene Summary

• Gene Symbol: PYGB   Gene   UCSC   Ensembl
• Aliases: GPBB
• Gene name: glycogen phosphorylase B
• Alternate names: glycogen phosphorylase, brain form, phosphorylase, glycogen; brain,
• Gene location: 20p11.21 (25248038: 25298011)     Exons: 20     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a glycogen phosphorylase found predominantly in the brain. The encoded protein forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzym
• OMIM: 606449

Protein Summary

• Protein general information: P11216  
  • Name: Glycogen phosphorylase, brain form (EC 2.4.1.1)
  • Length: 843  
  • Mass: 96696
• Sequence:

  MAKPLTDSEKRKQISVRGLAGLGDVAEVRKSFNRHLHFTLVKDRNVATPRDYFFALAHTVRDHLVGRWIRTQQHY
  YERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDLEELEEIEEDAGLGNGGLGRLAACFLDSMAT
  LGLAAYGYGIRYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAM
  PYDTPVPGYKNNTVNTMRLWSAKAPNDFKLQDFNVGDYIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
  VAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAIQLNDTHPALSIPELMRILVDVEKVDWDKAWEITKKTCAY
  TNHTVLPEALERWPVSMFEKLLPRHLEIIYAINQRHLDHVAALFPGDVDRLRRMSVIEEGDCKRINMAHLCVIGS
  HAVNGVARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLADTIVEKIGEEFLTDLSQLKKLLPL
  VSDEVFIRDVAKVKQENKLKFSAFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVVTLYNRIKRDPAKAFV
  PRTVMIGGKAAPGYHMAKLIIKLVTSIGDVVNHDPVVGDRLKVIFLENYRVSLAEKVIPAADLSQQISTAGTEAS
  GTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLRVEDVEALDRKGYNAREYYDHLPELKQAVDQISSGF
  FSPKEPDCFKDIVNMLMHHDRFKVFADYEAYMQCQAQVDQLYRNPKEWTKKVIRNIACSGKFSSDRTITEYAREI
  WGVEPSDLQIPPPNIPRD

• Structural information:
  • Interpro: IPR011833  IPR000811  IPR035090  
  • Prosite: PS00102
  • PDB: 5IKO 5IKP
  • PDBsum: 5IKO 5IKP
  • STRING: ENSP00000216962
• Other Databases: GeneCards:  PYGB  Malacards:  PYGB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008184	glycogen phosphorylase activity	IBA	molecular function
GO:0030170	pyridoxal phosphate binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005980	glycogen catabolic process	IBA	biological process
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008184	glycogen phosphorylase activity	IEA	molecular function
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0004645	1,4-alpha-oligoglucan phosphorylase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0102499	SHG alpha-glucan phosphorylase activity	IEA	molecular function
GO:0102250	linear malto-oligosaccharide phosphorylase activity	IEA	molecular function
GO:0004645	1,4-alpha-oligoglucan phosphorylase activity	IEA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0008184	glycogen phosphorylase activity	NAS	molecular function
GO:0005980	glycogen catabolic process	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04217	Necroptosis
hsa04910	Insulin signaling pathway
hsa04922	Glucagon signaling pathway
hsa04931	Insulin resistance
hsa00500	Starch and sucrose metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq