• Gene id: 58191

Gene Summary

• Gene Symbol: CXCL16   Gene   UCSC   Ensembl
• Aliases: CXCLG16, SR-PSOX, SRPSOX
• Gene name: C-X-C motif chemokine ligand 16
• Alternate names: C-X-C motif chemokine 16, CXC chemokine ligand 16, chemokine (C-X-C motif) ligand 16, scavenger receptor for phosphatidylserine and oxidized low density lipoprotein, small-inducible cytokine B16, transmembrane chemokine CXCL16,
• Gene location: 17p13.2 (17562469: 17592255)     Exons: 13     NC_000022.11
• OMIM: 605398

Protein Summary

• Protein general information: Q9H2A7  
  • Name: C X C motif chemokine 16 (Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein) (SR PSOX) (Small inducible cytokine B16) (Transmembrane chemokine CXCL16)
  • Length: 254  
  • Mass: 27579
  • Tissue specificity: Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.
• Sequence:

  MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQ
  LLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQR
  PTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYV
  LCKRRRGQSPQSSPDLPVHYIPVAPDSNT

• Structural information:
  • Interpro: IPR026296  
  • STRING: ENSP00000293778
• Other Databases: GeneCards:  CXCL16  Malacards:  CXCL16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0010818	T cell chemotaxis	IBA	biological process
GO:0005044	scavenger receptor activity	IBA	molecular function
GO:0005041	low-density lipoprotein particle receptor activity	IBA	molecular function
GO:0008009	chemokine activity	IEA	molecular function
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0034097	response to cytokine	IEA	biological process
GO:0034341	response to interferon-gamma	IEA	biological process
GO:0034612	response to tumor necrosis factor	IEA	biological process
GO:0005041	low-density lipoprotein particle receptor activity	IEA	molecular function
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0030307	positive regulation of cell growth	IEA	biological process
GO:0048247	lymphocyte chemotaxis	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0008009	chemokine activity	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0034097	response to cytokine	IDA	biological process
GO:0034341	response to interferon-gamma	IDA	biological process
GO:0034612	response to tumor necrosis factor	IDA	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0030307	positive regulation of cell growth	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0006935	chemotaxis	NAS	biological process
GO:0006898	receptor-mediated endocytosis	NAS	biological process
GO:0005041	low-density lipoprotein particle receptor activity	ISS	molecular function
GO:0005044	scavenger receptor activity	TAS	molecular function
GO:0008009	chemokine activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway

Diseases

Associated diseases	References
systemic scleroderma	PMID:21303517
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R