• Gene id: 5814

Gene Summary

• Gene Symbol: PURB   Gene   UCSC   Ensembl
• Aliases: PURBETA
• Gene name: purine rich element binding protein B
• Alternate names: transcriptional activator protein Pur-beta,
• Gene location: 7p13 (44885529: 44876298)     Exons: 1     NC_000007.14
• Gene summary(Entrez): This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of euka
• OMIM: 611025

Protein Summary

• Protein general information: Q96QR8  
  • Name: Transcriptional activator protein Pur beta (Purine rich element binding protein B)
  • Length: 312  
  • Mass: 33241
  • Tissue specificity: Expressed in myocardium of heart failure patients. {ECO
• Sequence:

  MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTL
  SMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTV
  NRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSI
  TVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGG
  GEESEGEEVDED

• Structural information:
  • Interpro: IPR006628  IPR030499  
  • STRING: ENSP00000379051
• Other Databases: GeneCards:  PURB  Malacards:  PURB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0032422	purine-rich negative regulatory element binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0008283	cell population proliferation	IEA	biological process
GO:0032422	purine-rich negative regulatory element binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0003729	mRNA binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0046332	SMAD binding	IEA	molecular function
GO:0008134	transcription factor binding	IEA	molecular function
GO:0005662	DNA replication factor A complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045637	regulation of myeloid cell differentiation	NAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0008134	transcription factor binding	ISS	molecular function
GO:0003697	single-stranded DNA binding	ISS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003729	mRNA binding	ISS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881