Search Result
| Gene id | 57798 | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | GATAD1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CMD2B, ODAG, RG083M05.2 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | GATA zinc finger domain containing 1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | GATA zinc finger domain-containing protein 1, ocular development-associated gene protein, | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
7q21.2 (92447447: 92494630) Exons: 11 NC_000007.14 |
||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene contains a zinc finger at the N-terminus, and is thought to bind to a histone modification site that regulates gene expression. Mutations in this gene have been associated with autosomal recessive dilated cardiomyopathy. A |
||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 614518 | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q8WUU5 Name: GATA zinc finger domain containing protein 1 (Ocular development associated gene protein) Length: 269 Mass: 28690 Tissue specificity: Ubiquitously expressed among various tissue types. Expressed in left ventricular myocytes. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSATPPQS NGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQ IGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHA PSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL | ||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: GATAD1  Malacards: GATAD1 | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||