• Gene id: 57732

Gene Summary

• Gene Symbol: ZFYVE28   Gene   UCSC   Ensembl
• Aliases: LST2, LYST2, lst-2
• Gene name: zinc finger FYVE-type containing 28
• Alternate names: lateral signaling target protein 2 homolog, hLst2, lateral signaling target-2 homolog, zinc finger FYVE domain-containing protein 28, zinc finger, FYVE domain containing 28,
• Gene location: 4p16.3 (2418697: 2269584)     Exons: 23     NC_000004.12
• OMIM: 611747

Protein Summary

• Protein general information: Q9HCC9  
  • Name: Lateral signaling target protein 2 homolog (hLst2) (Zinc finger FYVE domain containing protein 28)
  • Length: 887  
  • Mass: 96490
• Sequence:

  MMNRFRKWLYKPKRSDPQLLARFYYADEELNQVAAELDSLDGRKDPQRCTLLVSQFRSCQDNVLNIINQIMDECI
  PQDRAPRDFCVKFPEEIRHDNLAGQLWFGAECLAAGSIIMNRELESMAMRPLAKELTRSLEDVRGALRDQALRDL
  NTYTEKMREALRHFDVLFAEFELSYVSAMVPVKSPREYYVQQEVIVLFCETVERALDFGYLTQDMIDDYEPALMF
  SIPRLAIVCGLVVYADGPLNLDRKVEDMSELFRPFHTLLRKIRDLLQTLTEEELHTLERNLCISQDVEFPIRADV
  QGPAALAPALSAPLPPEGPLSAKAKDPDAELACSMQYDDQELEQLSRMVHRAGDEMSSLLSPPIACQSPAHRPGA
  EGSPGGEASPGRPRLRSGSDEEERVFFMDDVEGTAEALARPESPAGPFGWAGSTWADPQEKGQGGPGGAAGISLP
  ASEKEEDLSNNNLEAEGTDGASLAGTSSCSCLDSRLHLDGWEVGADDAETAEMIAHRTGGMKLSATVIFNPKSPT
  SLDSAVATQEAASEPVAEGMDGGPHKLSTGATNCLLHSCVCCGSCGDSREDVVERLREKCSPGGVIGASYAAGLA
  KASDRAPERQEEAPPPSEDASNGREPKAPTSDKCLPHTSGSQVDTASGLQGEAGVAGQQEPEARELHAGSPSAHE
  APQALSGSSSSTAGSCSSDKMGPEAAPAATHAAPQATREKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLR
  SILKTLFEVMATKPETDDKEKLRKVTQTLRSAALEDCALCQETLSSSELAAKTRDGDFEDPPEWVPDEACGFCTA
  CKAPFTVIRRKHHCRSCGKIFCSRCSSHSAPLPRYGQVKPVRVCTHCYMFHVTPFYSDKAGL

• Structural information:
  • Interpro: IPR000306  IPR017455  IPR011011  IPR013083  
  • Prosite: PS50178
  • STRING: ENSP00000290974
• Other Databases: GeneCards:  ZFYVE28  Malacards:  ZFYVE28

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007175	negative regulation of epidermal growth factor-activated receptor activity	IBA	biological process
GO:0031901	early endosome membrane	IBA	cellular component
GO:0031901	early endosome membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032266	phosphatidylinositol-3-phosphate binding	IDA	molecular function
GO:0007175	negative regulation of epidermal growth factor-activated receptor activity	IMP	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray