• Gene id: 57720

Gene Summary

• Gene Symbol: GPR107   Gene   UCSC   Ensembl
• Aliases: GCDRP, LUSTR1, bA138E2.2
• Gene name: G protein-coupled receptor 107
• Alternate names: protein GPR107, lung seven transmembrane receptor 1,
• Gene location: 9q34.11 (130053705: 130140168)     Exons: 31     NC_000009.12
• OMIM: 618490

Protein Summary

• Protein general information: Q5VW38  
  • Name: Protein GPR107 (Lung seven transmembrane receptor 1)
  • Length: 600  
  • Mass: 66990
• Sequence:

  MAALAPVGSPASRGPRLAAGLRLLPMLGLLQLLAEPGLGRVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLS
  LNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRD
  EKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYF
  HKCLGKELPSDKFTFSLDIEITEKNPDSYLSAGEIPLPKLYISMAFFFFLSGTIWIHILRKRRNDVFKIHWLMAA
  LPFTKSLSLVFHAIDYHYISSQGFPIEGWAVVYYITHLLKGALLFITIALIGTGWAFIKHILSDKDKKIFMIVIP
  LQVLANVAYIIIESTEEGTTEYGLWKDSLFLVDLLCCGAILFPVVWSIRHLQEASATDGKGDSMGPLQQRANLRA
  GSRIESHHFAQADLELLASSCPPASVSQRAGITAAINLAKLKLFRHYYVLIVCYIYFTRIIAFLLKLAVPFQWKW
  LYQLLDETATLVFFVLTGYKFRPASDNPYLQLSQEEEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGAV

• Structural information:
  • Interpro: IPR009637  
  • STRING: ENSP00000361483
• Other Databases: GeneCards:  GPR107  Malacards:  GPR107

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0072583	clathrin-dependent endocytosis	IBA	biological process
GO:0032050	clathrin heavy chain binding	IBA	molecular function
GO:0030136	clathrin-coated vesicle	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0072583	clathrin-dependent endocytosis	IEA	biological process
GO:0032050	clathrin heavy chain binding	IEA	molecular function
GO:0030136	clathrin-coated vesicle	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq