• Gene id: 57699

Gene Summary

• Gene Symbol: CPNE5   Gene   UCSC   Ensembl
• Aliases: COPN5, CPN5
• Gene name: copine 5
• Alternate names: copine-5, copine V,
• Gene location: 6p21.2 (36839997: 36740772)     Exons: 32     NC_000006.12
• Gene summary(Entrez): Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an in
• OMIM: 608756

Protein Summary

• Protein general information: Q9HCH3  
  • Name: Copine 5 (Copine V)
  • Length: 593  
  • Mass: 65734
  • Tissue specificity: Expressed in the brain, heart, stomach, spleen, lymph node and testis (PubMed
• Sequence:

  MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQWREFGRTEVIDNTLNPD
  FVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLGEIVGSPGSRLEKPLTIGAFSLNSRTGKPMP
  AVSNGGVPGKKCGTIILSAEELSNCRDVATMQFCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVMKNTL
  NPVWQTFSIPVRALCNGDYDRTIKVEVYDWDRDGSHDFIGEFTTSYRELARGQSQFNIYEVVNPKKKMKKKKYVN
  SGTVTLLSFAVESECTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMSPYQLNAYALALTAVGEIIQHYDS
  DKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQD
  GSQYSVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPF
  RDYVDRTGNHVLSMARLARDVLAEIPDQLVSYMKAQGIRPRPPPAAPTHSPSQSPARTPPASPLHTHI

• Structural information:
  • Protein Domains: (2..13-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (161..28-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (328..55-)
    (/note="VWFA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00219"-)
  • Interpro: IPR000008  IPR035892  IPR037768  IPR010734  IPR002035   IPR036465  
  • Prosite: PS50004 PS50234
  • CDD: cd04047 cd01459
  • STRING: ENSP00000244751
• Other Databases: GeneCards:  CPNE5  Malacards:  CPNE5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0005544	calcium-dependent phospholipid binding	IBA	molecular function
GO:0071277	cellular response to calcium ion	IBA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:1903861	positive regulation of dendrite extension	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq