• Gene id: 57658

Gene Summary

• Gene Symbol: CALCOCO1   Gene   UCSC   Ensembl
• Aliases: Cocoa, PP13275, calphoglin
• Gene name: calcium binding and coiled-coil domain 1
• Alternate names: calcium-binding and coiled-coil domain-containing protein 1, coiled-coil coactivator protein, coiled-coil leucine zipper coactivator 1, inorganic pyrophosphatase activator, sarcoma antigen NY-SAR-3,
• Gene location: 12q13.13 (53727519: 53708516)     Exons: 18     NC_000012.12

Protein Summary

• Protein general information: Q9P1Z2  
  • Name: Calcium binding and coiled coil domain containing protein 1 (Calphoglin) (Coiled coil coactivator protein) (Sarcoma antigen NY SAR 3)
  • Length: 691  
  • Mass: 77336
• Sequence:

  MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRDYHTFVWSSVPESTTD
  GSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFREPRPMDELVTLEEADGGSDILLVVPKATVLQ
  NQLDESQQERNDLMQLKLQLEGQVTELRSRVQELERALATARQEHTELMEQYKGISRSHGEITEERDILSRQQGD
  HVARILELEDDIQTISEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHLNLDL
  KEAKSWQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQELAASSQQKATLLGEELASAAAARDR
  TIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVEAEKDKILKLSAEILRLEKAVQEERTQNQVF
  KTELAREKDSSLVQLSESKRELTELRSALRVLQKEKEQLQEEKQELLEYMRKLEARLEKVADEKWNEDATTEDEE
  AAVGLSCPAALTDSEDESPEDMRLPPYGLCERGDPGSSPAGPREASPLVVISQPAPISPHLSGPAEDSSSDSEAE
  DEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDH
  MDGHFFFSTQDPFTFE

• Structural information:
  • Interpro: IPR012852  IPR041641  IPR041611  
  • Prosite: PS51905
  • DIP: 47322
  • STRING: ENSP00000449960
• Other Databases: GeneCards:  CALCOCO1  Malacards:  CALCOCO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003713	transcription coactivator activity	ISS	molecular function
GO:0007165	signal transduction	ISS	biological process
GO:0030518	intracellular steroid hormone receptor signaling pathway	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0003713	transcription coactivator activity	IMP	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0030374	nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030518	intracellular steroid hormone receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0003712	transcription coregulator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070016	armadillo repeat domain binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0003713	transcription coactivator activity	IMP	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq