• Gene id: 57620

Gene Summary

• Gene Symbol: STIM2   Gene   UCSC   Ensembl
• Gene name: stromal interaction molecule 2
• Alternate names: stromal interaction molecule 2,
• Gene location: 4p15.2 (26860840: 27025380)     Exons: 10     NC_000004.12
• Gene summary(Entrez): This gene is a member of the stromal interaction molecule (STIM) family and likely arose, along with related family member STIM1, from a common ancestral gene. The encoded protein functions to regulate calcium concentrations in the cytosol and endoplasmic
• OMIM: 610841

Protein Summary

• Protein general information: Q9P246  
  • Name: Stromal interaction molecule 2
  • Length: 746  
  • Mass: 83971
  • Tissue specificity: Expressed in all tissues and tumor cell lines examined. {ECO
• Sequence:

  MLVLGLLVAGAADGCELVPRHLRGRRATGSAATAASSPAAAAGDSPALMTDPCMSLSPPCFTEEDRFSLEALQTI
  HKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVE
  LPQYEKNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFILTVSIV
  IGVGGCWFAYTQNKTSKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRNVAVEKQNLERKMMDEINYAKEE
  ACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFELRSSWSVPDALQKWLQLTHEVEVQYYNIKRQNAEM
  QLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKALSELTTCLRERLFRWQQIEKICGFQIAHNSG
  LPSLTSSLYSDHSWVVMPRVSIPPYPIAGGVDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQ
  PQRAQLAPHAPHPSHPRHPHHPQHTPHSLPSPDPDILSVSSCPALYRNEEEEEAIYFSAEKQWEVPDTASECDSL
  NSSIGRKQSPPLSLEIYQTLSPRKISRDEVSLEDSSRGDSPVTVDVSWGSPDCVGLTETKSMIFSPASKVYNGIL
  EKSCSMNQLSSGIPVPKPRHTSCSSAGNDSKPVQEAPSVARISSIPHDLCHNGEKSKKPSKIKSLFKKKSK

• Structural information:
  • Protein Domains: (67..10-)
    (/note="EF-hand-)
    (136..20-)
    (/note="SAM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00184"-)
  • Interpro: IPR001660  IPR013761  IPR032393  IPR037608  IPR037610  
  • Prosite: PS50105
  • CDD: cd09574 cd11722
  • PDB: 2L5Y
  • PDBsum: 2L5Y
  • STRING: ENSP00000417569
• Other Databases: GeneCards:  STIM2  Malacards:  STIM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0002115	store-operated calcium entry	IBA	biological process
GO:0005246	calcium channel regulator activity	IBA	molecular function
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006874	cellular calcium ion homeostasis	IBA	biological process
GO:0032237	activation of store-operated calcium channel activity	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005246	calcium channel regulator activity	IEA	molecular function
GO:0006874	cellular calcium ion homeostasis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006816	calcium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0051928	positive regulation of calcium ion transport	IDA	biological process
GO:0015279	store-operated calcium channel activity	IDA	molecular function
GO:0032237	activation of store-operated calcium channel activity	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0051928	positive regulation of calcium ion transport	IMP	biological process
GO:0005246	calcium channel regulator activity	IMP	molecular function
GO:0032237	activation of store-operated calcium channel activity	IMP	biological process
GO:0006874	cellular calcium ion homeostasis	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04020	Calcium signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)