• Gene id: 57610

Gene Summary

• Gene Symbol: RANBP10   Gene   UCSC   Ensembl
• Gene name: RAN binding protein 10
• Alternate names: ran-binding protein 10,
• Gene location: 16q22.1 (67806559: 67723067)     Exons: 20     NC_000016.10
• Gene summary(Entrez): RAN is a small GTPase involved in the assembly of microtubules to form mitotic spindles. The protein encoded by this gene is a cytoplasmic guanine nucleotide exchange factor (GEF) that binds beta-tubulin and has GEF activity toward RAN. The encoded protei
• OMIM: 176877

Protein Summary

• Protein general information: Q6VN20  
  • Name: Ran binding protein 10 (RanBP10)
  • Length: 620  
  • Mass: 67257
  • Tissue specificity: Broadly expressed, with highest levels in skeletal muscle. {ECO
• Sequence:

  MAAATADPGAGNPQPGDSSGGGAGGGLPSPGEQELSRRLQRLYPAVNQQETPLPRSWSPKDKYNYIGLSQGNLRV
  HYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSF
  CSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTKNGHSLGIAFTDLPANLYPTVGLQTPGEIVDANFGQQPFLFD
  IEDYMREWRAKVQGTVHCFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFARMTETPIQEEQASIKNRQKIQK
  LVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVRSLSSRSPKSQDSYPGSPSLSPRHGPS
  SSHMHNTGADSPSCSNGVASTKSKQNHSKYPAPSSSSSSSSSSSSSSPSSVNYSESNSTDSTKSQHHSSTSNQET
  SDSEMEMEAEHYPNGVLGSMSTRIVNGAYKHEDLQTDESSMDDRHPRRQLCGGNQAATERIILFGRELQALSEQL
  GREYGKNLAHTEMLQDAFSLLAYSDPWSCPVGQQLDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLR
  LMARAGLGSCSFARVDDYLH

• Structural information:
  • Protein Domains: (35..22-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548-)
    (253..28-)
    (/note="LisH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00126-)
    (291..34-)
    (/note="CTLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00058"-)
  • Interpro: IPR001870  IPR013320  IPR013144  IPR024964  IPR006595   IPR006594  IPR003877  IPR035782  
  • Prosite: PS50188 PS50897 PS50896
  • CDD: cd12909
  • STRING: ENSP00000316589
• Other Databases: GeneCards:  RANBP10  Malacards:  RANBP10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007010	cytoskeleton organization	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0008536	Ran GTPase binding	IBA	molecular function
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq