• Gene id: 57594

Gene Summary

• Gene Symbol: HOMEZ   Gene   UCSC   Ensembl
• Aliases: KIAA1443
• Gene name: homeobox and leucine zipper encoding
• Alternate names: homeobox and leucine zipper protein Homez, homeodomain leucine zipper-containing factor,
• Gene location: 14q11.2 (23286131: 23272421)     Exons: 2     NC_000014.9
• OMIM: 617411

Protein Summary

• Protein general information: Q8IX15  
  • Name: Homeobox and leucine zipper protein Homez (Homeodomain leucine zipper containing factor)
  • Length: 550  
  • Mass: 61240
  • Tissue specificity: Ubiquitous. Strongly expressed in adult testis and kidney as well as fetal lung and kidney. {ECO
• Sequence:

  MVRGWEPPPGLDCAISEGHKSEGTMPPNKEASGLSSSPAGLICLPPISEELQLVWTQAAQTSELDSNEHLLKTFS
  YFPYPSLADIALLCLRYGLQMEKVKTWFMAQRLRCGISWSSEEIEETRARVVYRRDQLHFKSLLSFTHHAGRPPE
  EVPPPPVPAPEQVGIGIGPPTLSKPTQTKGLKVEPEEPSQMPPLPQSHQKLKESLMTPGSGAFPYQSDFWQHLQS
  SGLSKEQAGRGPNQSHGIGTASWNHSTTVPQPQARDKPPPIALIASSCKEESASSVTPSSSSTSSSFQVLANGAT
  AASKPLQPLGCVPQSVSPSEQALPPHLEPAWPQGLRHNSVPGRVGPTEYLSPDMQRQRKTKRKTKEQLAILKSFF
  LQCQWARREDYQKLEQITGLPRPEIIQWFGDTRYALKHGQLKWFRDNAVPGAPSFQDPAIPTPPPSTRSLNERAE
  TPPLPIPPPPPDIQPLERYWAAHQQLRETDIPQLSQASRLSTQQVLDWFDSRLPQPAEVVVCLDEEEEEEEEELP
  EDDEEEEEEEEEDDDDDDDDVIIQD

• Structural information:
  • Interpro: IPR009057  IPR001356  IPR008422  IPR024578  
  • Prosite: PS50071
  • CDD: cd00086
  • PDB: 2ECC 2YS9
  • PDBsum: 2ECC 2YS9
  • STRING: ENSP00000350049
• Other Databases: GeneCards:  HOMEZ  Malacards:  HOMEZ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R