• Gene id: 57552

Gene Summary

• Gene Symbol: NCEH1   Gene   UCSC   Ensembl
• Aliases: AADACL1, NCEH
• Gene name: neutral cholesterol ester hydrolase 1
• Alternate names: neutral cholesterol ester hydrolase 1, acetylalkylglycerol acetylhydrolase, alkylacetylglycerol acetylhydrolase, arylacetamide deacetylase-like 1,
• Gene location: 3q26.31 (172711066: 172630248)     Exons: 5     NC_000003.12
• OMIM: 608208

Protein Summary

• Protein general information: Q6PIU2  
  • Name: Neutral cholesterol ester hydrolase 1 (NCEH) (EC 3.1.1. ) (Arylacetamide deacetylase like 1)
  • Length: 408  
  • Mass: 45808
  • Tissue specificity: Expressed in monocyte-derived macrophages. Up-regulated in invasive melanoma and breast carcinoma cell lines. {ECO
• Sequence:

  MRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVSNLIHYLGLSHHLLALNFIIVSFGKKSAW
  SSAQVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLV
  PKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQ
  ALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNY
  KPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDGIMYAKRLESAGVEVTLDHFED
  GFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL

• Structural information:
  • Interpro: IPR029058  IPR013094  IPR017157  IPR033140  
  • Prosite: PS01174
  • STRING: ENSP00000442464
• Other Databases: GeneCards:  NCEH1  Malacards:  NCEH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016787	hydrolase activity	IBA	molecular function
GO:0009056	catabolic process	IBA	biological process
GO:0034338	short-chain carboxylesterase activity	IBA	molecular function
GO:0046485	ether lipid metabolic process	ISS	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016042	lipid catabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0034383	low-density lipoprotein particle clearance	TAS	biological process
GO:0004771	sterol esterase activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04934	Cushing syndrome
hsa04976	Bile secretion
hsa04927	Cortisol synthesis and secretion
hsa04979	Cholesterol metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq