• Gene id: 57408

Gene Summary

• Gene Symbol: LRTM1   Gene   UCSC   Ensembl
• Aliases: HT017
• Gene name: leucine rich repeats and transmembrane domains 1
• Alternate names: leucine-rich repeat and transmembrane domain-containing protein 1,
• Gene location: 3p14.3 (54967101: 54918230)     Exons: 4     NC_000003.12

Protein Summary

• Protein general information: Q9HBL6  
  • Name: Leucine rich repeat and transmembrane domain containing protein 1
  • Length: 345  
  • Mass: 38171
• Sequence:

  MKGELLLFSSVIVLLQVVCSCPDKCYCQSSTNFVDCSQQGLAEIPSHLPPQTRTLHLQDNQIHHLPAFAFRSVPW
  LMTLNLSNNSLSNLAPGAFHGLQHLQVLNLTQNSLLSLESRLFHSLPQLRELDLSSNNISHLPTSLGETWENLTI
  LAVQQNQLQQLDRALLESMPSVRLLLLKDNLWKCNCHLLGLKLWLEKFVYKGGLTDGIICESPDTWKGKDLLRIP
  HELYQPCPLPAPDPVSSQAQWPGSAHGVVLRPPENHNAGERELLECELKPKPRPANLRHAIATVIITGVVCGIVC
  LMMLAAAIYGCTYAAITAQYHGGPLAQTNDPGKVEEKERFDSSPA

• Structural information:
  • Protein Domains: (28..5-)
    (/note="LRRNT-)
    (180..23-)
    (/note="LRRCT"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • STRING: ENSP00000273286
• Other Databases: GeneCards:  LRTM1  Malacards:  LRTM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007411	axon guidance	IBA	biological process
GO:0008201	heparin binding	IBA	molecular function
GO:0048495	Roundabout binding	IBA	molecular function
GO:0050919	negative chemotaxis	IBA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)