• Gene id: 57405

Gene Summary

• Gene Symbol: SPC25   Gene   UCSC   Ensembl
• Aliases: AD024, SPBC25, hSpc25
• Gene name: SPC25 component of NDC80 kinetochore complex
• Alternate names: kinetochore protein Spc25, 2600017H08Rik, SPC25, NDC80 kinetochore complex component, homolog, spindle pole body component 25 homolog,
• Gene location: 2q24.3 (168890442: 168865044)     Exons: 8     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein that may be involved in kinetochore-microtubule interaction and spindle checkpoint activity. [provided by RefSeq, Jul 2008]
• OMIM: 600141

Protein Summary

• Protein general information: Q9HBM1  
  • Name: Kinetochore protein Spc25 (hSpc25)
  • Length: 224  
  • Mass: 26153
• Sequence:

  MVEDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEMFLEYQNQISRQNKLI
  QEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTANKANAERLKRLQKSADLYKDRLGLEIRKIY
  GEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVYN

• Structural information:
  • Interpro: IPR013255  
  • PDB: 2VE7 3IZ0
  • PDBsum: 2VE7 3IZ0
  • DIP: 35753
  • STRING: ENSP00000282074
• Other Databases: GeneCards:  SPC25  Malacards:  SPC25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031262	Ndc80 complex	IBA	cellular component
GO:0007059	chromosome segregation	IBA	biological process
GO:0000777	condensed chromosome kinetochore	IBA	cellular component
GO:0031262	Ndc80 complex	IDA	cellular component
GO:0007052	mitotic spindle organization	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000776	kinetochore	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000777	condensed chromosome kinetochore	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray