• Gene id: 5734

Gene Summary

• Gene Symbol: PTGER4   Gene   UCSC   Ensembl
• Aliases: EP4, EP4R
• Gene name: prostaglandin E receptor 4
• Alternate names: prostaglandin E2 receptor EP4 subtype, PGE receptor, EP4 subtype, PGE2 receptor EP4 subtype, prostaglandin E receptor 4 (subtype EP4), prostanoid EP4 receptor,
• Gene location: 5p13.1 (40679914: 40740935)     Exons: 7     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 indu
• OMIM: 601586

Protein Summary

• Protein general information: P35408  
  • Name: Prostaglandin E2 receptor EP4 subtype (PGE receptor EP4 subtype) (PGE2 receptor EP4 subtype) (Prostanoid EP4 receptor)
  • Length: 488  
  • Mass: 53119
  • Tissue specificity: High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle.
• Sequence:

  MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCGLAVTDLLGTLLVSPV
  TIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLAINHAYFYSHYVDKRLAGLTLFAVYASNVLF
  CALPNMGLGSSRLQYPDTWCFIDWTTNVTAHAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGT
  EQHHAAAAASVASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
  SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSGQHCSDSQRTSSAMSG
  HSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSES
  VLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR001758  IPR008365  IPR001244  
  • Prosite: PS00237 PS50262
  • PDB: 5YHL 5YWY
  • PDBsum: 5YHL 5YWY
  • DIP: 61099
  • STRING: ENSP00000302846
• Other Databases: GeneCards:  PTGER4  Malacards:  PTGER4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071380	cellular response to prostaglandin E stimulus	IBA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004957	prostaglandin E receptor activity	IBA	molecular function
GO:0050728	negative regulation of inflammatory response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0004957	prostaglandin E receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004955	prostaglandin receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0051492	regulation of stress fiber assembly	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0050715	positive regulation of cytokine secretion	IEA	biological process
GO:0050710	negative regulation of cytokine secretion	IEA	biological process
GO:0042093	T-helper cell differentiation	IEA	biological process
GO:0030278	regulation of ossification	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0033624	negative regulation of integrin activation	IDA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0050728	negative regulation of inflammatory response	IDA	biological process
GO:2000420	negative regulation of eosinophil extravasation	IDA	biological process
GO:0004957	prostaglandin E receptor activity	IDA	molecular function
GO:0071260	cellular response to mechanical stimulus	ISS	biological process
GO:0006955	immune response	IEP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051492	regulation of stress fiber assembly	ISS	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0050715	positive regulation of cytokine secretion	ISS	biological process
GO:0007254	JNK cascade	ISS	biological process
GO:0070371	ERK1 and ERK2 cascade	ISS	biological process
GO:0050710	negative regulation of cytokine secretion	ISS	biological process
GO:0042093	T-helper cell differentiation	ISS	biological process
GO:0009612	response to mechanical stimulus	IEP	biological process
GO:0060348	bone development	ISS	biological process
GO:0016021	integral component of membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04080	Neuroactive ligand-receptor interaction
hsa05165	Human papillomavirus infection
hsa05163	Human cytomegalovirus infection
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04924	Renin secretion

Diseases

Associated diseases	References
Arteriosclerosis	PMID:16020747
Aortic aneurysm	PMID:22570740
Ankylosing spondylitis	PMID:21743469
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881