• Gene id: 5729

Gene Summary

• Gene Symbol: PTGDR   Gene   UCSC   Ensembl
• Aliases: AS1, ASRT1, DP, DP1, PTGDR1
• Gene name: prostaglandin D2 receptor
• Alternate names: prostaglandin D2 receptor, PGD2 receptor,
• Gene location: 14q22.1 (52267255: 52276723)     Exons: 13     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pat
• OMIM: 604687

Protein Summary

• Protein general information: Q13258  
  • Name: Prostaglandin D2 receptor (PGD receptor) (PGD2 receptor) (Prostanoid DP receptor)
  • Length: 359  
  • Mass: 40271
  • Tissue specificity: Expressed in retinal choroid, ciliary epithelium, longitudinal and circular ciliary muscles, iris, small intestine and platelet membranes. {ECO
• Sequence:

  MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSVFYMLVCGLTVTDLLG
  KCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSSTLQLLAMALECWLSLGHPFFYRRHITLRLGA
  LVAPVVSAFSLAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNL
  YAMHRRLQRHPRSCTRDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
  EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000376  IPR008365  
  • Prosite: PS50262
  • STRING: ENSP00000303424
• Other Databases: GeneCards:  PTGDR  Malacards:  PTGDR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0004956	prostaglandin D receptor activity	IBA	molecular function
GO:0004956	prostaglandin D receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0004956	prostaglandin D receptor activity	IEA	molecular function
GO:0001785	prostaglandin J receptor activity	IEA	molecular function
GO:0071799	cellular response to prostaglandin D stimulus	IEA	biological process
GO:0046085	adenosine metabolic process	IEA	biological process
GO:0030431	sleep	IEA	biological process
GO:0030238	male sex determination	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004956	prostaglandin D receptor activity	NAS	molecular function
GO:0016021	integral component of membrane	NAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Cerebral infarction	PMID:19576888
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881