• Gene id: 57147

Gene Summary

• Gene Symbol: SCYL3   Gene   UCSC   Ensembl
• Aliases: PACE-1, PACE1
• Gene name: SCY1 like pseudokinase 3
• Alternate names: protein-associating with the carboxyl-terminal domain of ezrin, SCY1-like 3, SCY1-like protein 3, SCY1-like, kinase-like 3, ezrin-binding partner PACE-1 (PACE-1), ezrin-binding protein PACE-1,
• Gene location: 1q24.2 (169894266: 169849630)     Exons: 15     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein with a kinase domain and four HEAT repeats. The encoded protein interacts with the C-terminal domain of ezrin, an ERM protein, and may play a role in cell adhesion and migration. Alternative splicing results in multiple transcr
• OMIM: 300463

Protein Summary

• Protein general information: Q8IZE3  
  • Name: Protein associating with the carboxyl terminal domain of ezrin (Ezrin binding protein PACE 1) (SCY1 like protein 3)
  • Length: 742  
  • Mass: 82857
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKVNKAAKHLKTLRHPCLLRFLSCTVEA
  DGIHLVTERVQPLEVALETLSSAEVCAGIYDILLALIFLHDRGHLTHNNVCLSSVFVSEDGHWKLGGMETVCKVS
  QATPEFLRSIQSIRDPASIPPEEMSPEFTTLPECHGHARDAFSFGTLVESLLTILNEQVSADVLSSFQQTLHSTL
  LNPIPKCRPALCTLLSHDFFRNDFLEVVNFLKSLTLKSEEEKTEFFKFLLDRVSCLSEELIASRLVPLLLNQLVF
  AEPVAVKSFLPYLLGPKKDHAQGETPCLLSPALFQSRVIPVLLQLFEVHEEHVRMVLLSHIEAYVEHFTQEQLKK
  VILPQVLLGLRDTSDSIVAITLHSLAVLVSLLGPEVVVGGERTKIFKRTAPSFTKNTDLSLEDSPMCVVCSHHSQ
  ISPILENPFSSIFPKCFFSGSTPINSKKHIQRDYYNTLLQTGDPFSQPIKFPINGLSDVKNTSEDSENFPSSSKK
  SEEWPDWSEPEEPENQTVNIQIWPREPCDDVKSQCTTLDVEESSWDDCEPSSLDTKVNPGGGITATKPVTSGEQK
  PIPALLSLTEESMPWKSSLPQKISLVQRGDDADQIEPPKVSSQERPLKVPSELGLGEEFTIQVKKKPVKDPEMDW
  FADMIPEIKPSAAFLILPELRTEMVPKKDDVSPVMQFSSKFAAAEITEGEAEGWEEEGELNWEDNNW

• Structural information:
  • Protein Domains: (2..24-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011989  IPR016024  IPR021133  IPR011009  IPR000719  
  • Prosite: PS50077 PS50011
  • STRING: ENSP00000356746
• Other Databases: GeneCards:  SCYL3  Malacards:  SCYL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0021522	spinal cord motor neuron differentiation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0048666	neuron development	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0034613	cellular protein localization	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016301	kinase activity	IDA	NOT|molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016477	cell migration	NAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881