• Gene id: 57143

Gene Summary

• Gene Symbol: ADCK1   Gene   UCSC   Ensembl
• Gene name: aarF domain containing kinase 1
• Alternate names: aarF domain-containing protein kinase 1,
• Gene location: 14q24.3 (77800063: 77935013)     Exons: 17     NC_000014.9

Protein Summary

• Protein general information: Q86TW2  
  • Name: AarF domain containing protein kinase 1 (EC 2.7. . )
  • Length: 530  
  • Mass: 60577
• Sequence:

  MARKALKLASWTSMALAASGIYFYSNKYLDPNDFGAVRVGRAVATTAVISYDYLTSLKSVPYGSEEYLQLRSKSW
  PVFLQVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQVIREDLGKEIH
  DLFQSFDDTPLGTASLAQVHKAVLHDGRTVAVKVQHPKVRAQSSKDILLMEVLVLAVKQLFPEFEFMWLVDEAKK
  NLPLELDFLNEGRNAEKVSQMLRHFDFLKVPRIHWDLSTERVLLMEFVDGGQVNDRDYMERNKIDVNEISRHLGK
  MYSEMIFVNGFVHCDPHPGNVLVRKHPGTGKAEIVLLDHGLYQMLTEEFRLNYCHLWQSLIWTDMKRVKEYSQRL
  GAGDLYPLFACMLTARSWDSVNRGISQAPVTATEDLEIRNNAANYLPQISHLLNHVPRQMLLILKTNDLLRGIEA
  ALGTRASASSFLNMSRCCIRALAEHKKKNTCSFFRRTQISFSEAFNLWQINLHELILRVKGLKLADRVLALICWL
  FPAPL

• Structural information:
  • Protein Domains: (155..46-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR004147  
  • STRING: ENSP00000238561
• Other Databases: GeneCards:  ADCK1  Malacards:  ADCK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010637	negative regulation of mitochondrial fusion	IBA	biological process
GO:1903852	positive regulation of cristae formation	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:1903852	positive regulation of cristae formation	IMP	biological process
GO:0010637	negative regulation of mitochondrial fusion	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq