• Gene id: 57129

Gene Summary

• Gene Symbol: MRPL47   Gene   UCSC   Ensembl
• Aliases: CGI-204, L47mt, MRP-L47, NCM1
• Gene name: mitochondrial ribosomal protein L47
• Alternate names: 39S ribosomal protein L47, mitochondrial, mitochondrial large ribosomal subunit protein uL29m, nasopharyngeal carcinoma metastasis-related 1, nasopharyngeal carcinoma metastasis-related protein 1,
• Gene location: 3q26.33 (179604645: 179588284)     Exons: 7     NC_000003.12
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611852

Protein Summary

• Protein general information: Q9HD33  
  • Name: 39S ribosomal protein L47, mitochondrial (L47mt) (MRP L47) (Mitochondrial large ribosomal subunit protein uL29m) (Nasopharyngeal carcinoma metastasis related protein 1)
  • Length: 250  
  • Mass: 29450
• Sequence:

  MAAAGLALLCRRVSSALKSSRSLITPQVPACTGFFLSLLPKSTPNVTSFHQYRLLHTTLSRKGLEEFFDDPKNWG
  QEKVKSGAAWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLDKVVDSMDALDKVVQERE
  DALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRYNRKRFFALPYVDHFLRLEREKRARIKARKEN
  LERKKAKILLKKFPHLAEAQKSSLV

• Structural information:
  • Interpro: IPR038340  IPR010729  
  • PDB: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000417602
• Other Databases: GeneCards:  MRPL47  Malacards:  MRPL47

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005761	mitochondrial ribosome	IEA	cellular component
GO:0032543	mitochondrial translation	IBA	biological process
GO:0005762	mitochondrial large ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)