• Gene id: 57127

Gene Summary

• Gene Symbol: RHBG   Gene   UCSC   Ensembl
• Aliases: SLC42A2
• Gene name: Rh family B glycoprotein
• Alternate names: ammonium transporter Rh type B, Rhesus blood group, B glycoprotein,
• Gene location: 1q22 (40405786: 40435947)     Exons: 17     NC_000015.10
• Gene summary(Entrez): This gene encodes one of two non-erythroid members of the Rhesus (Rh) protein family. Non-erythroid Rh protein family members are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. All Rh fa
• OMIM: 607079

Protein Summary

• Protein general information: Q9H310  
  • Name: Ammonium transporter Rh type B (Rhesus blood group family type B glycoprotein) (Rh family type B glycoprotein) (Rh type B glycoprotein)
  • Length: 441  
  • Mass: 47231
  • Tissue specificity: Specifically expressed in kidney. Also detected in liver and ovary. {ECO
• Sequence:

  MAGSPSRAAGRRLQLPLLCLFLQGATAVLFAVFVRYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGF
  GFLMVFLQRYGFSSVGFTFLLAAFALQWSTLVQGFLHSFHGGHIHVGVESMINADFCAGAVLISFGAVLGKTGPT
  QLLLMALLEVVLFGINEFVLLHLLGVRDAGGSMTIHTFGAYFGLVLSRVLYRPQLEKSKHRQGSVYHSDLFAMIG
  TIFLWIFWPSFNAALTALGAGQHRTALNTYYSLAASTLGTFALSALVGEDGRLDMVHIQNAALAGGVVVGTSSEM
  MLTPFGALAAGFLAGTVSTLGYKFFTPILESKFKVQDTCGVHNLHGMPGVLGALLGVLVAGLATHEAYGDGLESV
  FPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLGGLLLKLPFLDSPPRLPALRGPSSLAGAWRA

• Structural information:
  • Interpro: IPR029020  IPR024041  IPR002229  
  • STRING: ENSP00000441197
• Other Databases: GeneCards:  RHBG  Malacards:  RHBG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008519	ammonium transmembrane transporter activity	IBA	molecular function
GO:0072488	ammonium transmembrane transport	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0008519	ammonium transmembrane transporter activity	IEA	molecular function
GO:0015696	ammonium transport	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0015696	ammonium transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008519	ammonium transmembrane transporter activity	TAS	molecular function
GO:0008519	ammonium transmembrane transporter activity	TAS	molecular function
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0015696	ammonium transport	IDA	biological process
GO:0015696	ammonium transport	IDA	biological process
GO:0008519	ammonium transmembrane transporter activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070634	transepithelial ammonium transport	IDA	biological process
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0015696	ammonium transport	IDA	biological process
GO:0008519	ammonium transmembrane transporter activity	IDA	molecular function
GO:0008519	ammonium transmembrane transporter activity	IDA	molecular function
GO:0046658	anchored component of plasma membrane	IMP	cellular component
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0015696	ammonium transport	ISS	biological process
GO:0030506	ankyrin binding	IPI	molecular function
GO:0030506	ankyrin binding	IPI	molecular function
GO:0014731	spectrin-associated cytoskeleton	IMP	cellular component
GO:0008519	ammonium transmembrane transporter activity	ISS	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R