• Gene id: 57099

Gene Summary

• Gene Symbol: AVEN   Gene   UCSC   Ensembl
• Aliases: PDCD12
• Gene name: apoptosis and caspase activation inhibitor
• Alternate names: cell death regulator Aven, apoptosis, caspase activation inhibitor, programmed cell death 12,
• Gene location: 15q14 (34074876: 33851784)     Exons: 15     NC_000015.10
• OMIM: 602279

Protein Summary

• Protein general information: Q9NQS1  
  • Name: Cell death regulator Aven
  • Length: 362  
  • Mass: 38506
  • Tissue specificity: Highly expressed in testis, ovary, thymus, prostate, spleen, small intestine, colon, heart, skeletal muscle, liver, kidney and pancreas.
• Sequence:

  MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGS
  RREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGD
  SFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGL
  GMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGD
  NILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSMIS

• Structural information:
  • Interpro: IPR026187  
  • STRING: ENSP00000306822
• Other Databases: GeneCards:  AVEN  Malacards:  AVEN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010972	negative regulation of G2/M transition of mitotic cell cycle	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881