• Gene id: 57026

Gene Summary

• Gene Symbol: PDXP   Gene   UCSC   Ensembl
• Aliases: CIN, PLP, dJ37E16.5
• Gene name: pyridoxal phosphatase
• Alternate names: pyridoxal phosphate phosphatase, PLP phosphatase, chronophin, pyridoxal (pyridoxine, vitamin B6) phosphatase, testicular secretory protein Li 36,
• Gene location: 22q13.1 (37658722: 37666931)     Exons: 2     NC_000022.11
• Gene summary(Entrez): Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP (Jang et al., 200
• OMIM: 610109

Protein Summary

• Protein general information: Q96GD0  
  • Name: Pyridoxal phosphate phosphatase (PLP phosphatase) (EC 3.1.3.3) (EC 3.1.3.74) (Chronophin)
  • Length: 296  
  • Mass: 31698
  • Tissue specificity: Ubiquitously expressed (at protein level) (PubMed
• Sequence:

  MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGERAVPGAPELLERLARAGKAALFVSNNSRRARPELALRFARL
  GFGGLRAEQLFSSALCAARLLRQRLPGPPDAPGAVFVLGGEGLRAELRAAGLRLAGDPSAGDGAAPRVRAVLVGY
  DEHFSFAKLREACAHLRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITEN
  FSIDPARTLMVGDRLETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVPHYYVESIADLTEGLED

• Structural information:
  • Interpro: IPR036412  IPR006357  IPR023214  IPR006349  
  • PDB: 2CFR 2CFS 2CFT 2OYC 2P27 2P69 5GYN
  • PDBsum: 2CFR 2CFS 2CFT 2OYC 2P27 2P69 5GYN
  • STRING: ENSP00000215904
• Other Databases: GeneCards:  PDXP  Malacards:  PDXP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016311	dephosphorylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0016791	phosphatase activity	IBA	molecular function
GO:0033883	pyridoxal phosphatase activity	IBA	molecular function
GO:0070938	contractile ring	IDA	colocalizes with
GO:0032587	ruffle membrane	IDA	colocalizes with
GO:0015629	actin cytoskeleton	IDA	colocalizes with
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IDA	molecular function
GO:0032154	cleavage furrow	IDA	colocalizes with
GO:0030496	midbody	IDA	colocalizes with
GO:0030027	lamellipodium	IDA	colocalizes with
GO:0005886	plasma membrane	IDA	colocalizes with
GO:0032361	pyridoxal phosphate catabolic process	ISS	biological process
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0033883	pyridoxal phosphatase activity	ISS	molecular function
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0030836	positive regulation of actin filament depolymerization	IMP	biological process
GO:0007088	regulation of mitotic nuclear division	IMP	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004647	phosphoserine phosphatase activity	IEA	molecular function
GO:0033883	pyridoxal phosphatase activity	IEA	molecular function
GO:0071318	cellular response to ATP	IDA	biological process
GO:0031247	actin rod assembly	IDA	biological process
GO:0004721	phosphoprotein phosphatase activity	IDA	molecular function
GO:0031072	heat shock protein binding	IDA	molecular function
GO:0031247	actin rod assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0032361	pyridoxal phosphate catabolic process	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0033883	pyridoxal phosphatase activity	IEA	molecular function
GO:0032587	ruffle membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0031258	lamellipodium membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00750	Vitamin B6 metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray