• Gene id: 56981

Gene Summary

• Gene Symbol: PRDM11   Gene   UCSC   Ensembl
• Aliases: PFM8
• Gene name: PR/SET domain 11
• Alternate names: PR domain-containing protein 11, PR-domain containing protein 11,
• Gene location: 11p11.2 (45094012: 45235123)     Exons: 13     NC_000011.10
• OMIM: 608348

Protein Summary

• Protein general information: Q9NQV5  
  • Name: PR domain containing protein 11 (EC 2.1.1. )
  • Length: 511  
  • Mass: 57863
  • Tissue specificity: Highly expressed in lung, including bronchial epithelial cells and airway smooth muscle cells, as well as in peripheral blood mononuclear cells. In tonsils, expressed in B-cell types, including naive B-cells, centroblasts, centrocytes
• Sequence:

  MLKMAEPIASLMIVECRACLRCSPLFLYQREKDRMTENMKECLAQTNAAVGDMVTVVKTEVCSPLRDQEYGQPCS
  RRPDSSAMEVEPKKLKGKRDLIVPKSFQQVDFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIPDRAALTIPQG
  MEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQDKSAGFFSWLIVDKNNRYKSIDGSDETKANWMRYVVISR
  EEREQNLLAFQHSERIYFRACRDIRPGEWLRVWYSEDYMKRLHSMSQETIHRNLARGEKRLQREKSEQVLDNPED
  LRGPIHLSVLRQGKSPYKRGFDEGDVHPQAKKKKIDLIFKDVLEASLESAKVEAHQLALSTSLVIRKVPKYQDDA
  YSQCATTMTHGVQNIGQTQGEGDWKVPQGVSKEPGQLEDEEEEPSSFKADSPAEASLASDPHELPTTSFCPNCIR
  LKKKVRELQAELDMLKSGKLPEPPVLPPQVLELPEFSDPAGKLVWMRLLSEGRVRSGLCGG

• Structural information:
  • Protein Domains: (149..26-)
    (/note="SET-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00190"-)
  • Interpro: IPR001214  
  • Prosite: PS50280
  • PDB: 3RAY
  • PDBsum: 3RAY
  • STRING: ENSP00000480626
• Other Databases: GeneCards:  PRDM11  Malacards:  PRDM11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0042054	histone methyltransferase activity	IBA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016571	histone methylation	IEA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:2000271	positive regulation of fibroblast apoptotic process	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003682	chromatin binding	ISS	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0043408	regulation of MAPK cascade	IMP	biological process
GO:0051726	regulation of cell cycle	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq