• Gene id: 56963

Gene Summary

• Gene Symbol: RGMA   Gene   UCSC   Ensembl
• Aliases: RGM
• Gene name: repulsive guidance molecule BMP co-receptor a
• Alternate names: repulsive guidance molecule A, RGM domain family, member A, repulsive guidance molecule family member a,
• Gene location: 15q26.1 (162069690: 162370474)     Exons: 10     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the repulsive guidance molecule family. The encoded protein is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. This protein m
• OMIM: 607362

Protein Summary

• Protein general information: Q96B86  
  • Name: Repulsive guidance molecule A (RGM domain family member A)
  • Length: 450  
  • Mass: 49347
• Sequence:

  MQPPRERLVVTGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSEFWSATSGSHAPASDDTPEF
  CAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGPTSQPRLRTLPPAGDSQERSDSPEICHYEKS
  FHKHSATPNYTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQE
  CVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEV
  VNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYY
  QACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYDRTRDLPGRAAAGLPLAPRPLLGALVPLLALLPVFC

• Structural information:
  • Interpro: IPR016123  IPR040287  IPR009496  IPR010536  IPR033607  
  • PDB: 4UHY
  • PDBsum: 4UHY
  • DIP: 61606
  • STRING: ENSP00000452126
• Other Databases: GeneCards:  RGMA  Malacards:  RGMA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0015026	coreceptor activity	IBA	molecular function
GO:0030509	BMP signaling pathway	IBA	biological process
GO:0010975	regulation of neuron projection development	IEA	biological process
GO:0048681	negative regulation of axon regeneration	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0030509	BMP signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1990459	transferrin receptor binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance
hsa04350	TGF-beta signaling pathway

Diseases

Associated diseases	References
Multiple sclerosis	PMID:20072140
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray