• Gene id: 56948

Gene Summary

• Gene Symbol: SDR39U1   Gene   UCSC   Ensembl
• Aliases: C14orf124, HCDI
• Gene name: short chain dehydrogenase/reductase family 39U member 1
• Alternate names: epimerase family protein SDR39U1,
• Gene location: 14q12 (24442904: 24439764)     Exons: 7     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) superfamily, which includes both classical and extended types. The encoded protein represents an extended type, with similarity to epimerases. Alternatively spliced transcript v
• OMIM: 616162

Protein Summary

• Protein general information: Q9NRG7  
  • Name: Epimerase family protein SDR39U1 (EC 1.1.1. ) (Short chain dehydrogenase/reductase family 39U member 1)
  • Length: 293  
  • Mass: 31077
  • Tissue specificity: Expressed in adrenal gland.
• Sequence:

  MRVLVGGGTGFIGTALTQLLNARGHEVTLVSRKPGPGRITWDELAASGLPSCDAAVNLAGENILNPLRRWNETFQ
  KEVIGSRLETTQLLAKAITKAPQPPKAWVLVTGVAYYQPSLTAEYDEDSPGGDFDFFSNLVTKWEAAARLPGDST
  RQVVVRSGVVLGRGGGAMGHMLLPFRLGLGGPIGSGHQFFPWIHIGDLAGILTHALEANHVHGVLNGVAPSSATN
  AEFAQTLGAALGRRAFIPLPSAVVQAVFGRQRAIMLLEGQKVIPQRTLATGYQYSFPELGAALKEIVA

• Structural information:
  • Interpro: IPR013549  IPR001509  IPR036291  IPR010099  
  • PDB: 4B4O
  • PDBsum: 4B4O
  • STRING: ENSP00000382327
• Other Databases: GeneCards:  SDR39U1  Malacards:  SDR39U1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003824	catalytic activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)