Search Result
| Gene id | 56934 | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||
| Gene Symbol | CA10 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||
| Aliases | CA-RPX, CARPX, HUCEP-15 | ||||||||||||||||||||||||||||||||
| Gene name | carbonic anhydrase 10 | ||||||||||||||||||||||||||||||||
| Alternate names | carbonic anhydrase-related protein 10, CA-RP X, CARP X, carbonic anhydrase X, carbonic anhydrase-related protein X, cerebral protein-15, epididymis secretory sperm binding protein, | ||||||||||||||||||||||||||||||||
| Gene location |
17q21.33-q22 (52160016: 51630312) Exons: 12 NC_000017.11 |
||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the al |
||||||||||||||||||||||||||||||||
| OMIM | 604642 | ||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||
| Protein general information | Q9NS85 Name: Carbonic anhydrase related protein 10 (Carbonic anhydrase related protein X) (CA RP X) (CARP X) (Cerebral protein 15) Length: 328 Mass: 37563 Tissue specificity: Strong expression in brain and central nervous system. {ECO | ||||||||||||||||||||||||||||||||
| Sequence |
MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSH MIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQ AFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEEL YPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN INFSLQGKDCPNNRAQKLQYRVNEWLLK | ||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: CA10  Malacards: CA10 | ||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||