• Gene id: 56920

Gene Summary

• Gene Symbol: SEMA3G   Gene   UCSC   Ensembl
• Aliases: sem2
• Gene name: semaphorin 3G
• Alternate names: semaphorin-3G, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3G, semaphorin sem2,
• Gene location: 3p21.1 (52445112: 52433034)     Exons: 17     NC_000003.12
• Gene summary(Entrez): The transcription of this gene is activated by PPAR-gamma, and the resulting protein product plays a role in endothelial cell migration. Expression of this gene also inhibits tumor cell migration and invasion. [provided by RefSeq, Jul 2016]

Protein Summary

• Protein general information: Q9NS98  
  • Name: Semaphorin 3G (Semaphorin sem2)
  • Length: 782  
  • Mass: 86701
• Sequence:

  MAPSAWAICWLLGGLLLHGGSSGPSPGPSVPRLRLSYRDLLSANRSAIFLGPQGSLNLQAMYLDEYRDRLFLGGL
  DALYSLRLDQAWPDPREVLWPPQPGQREECVRKGRDPLTECANFVRVLQPHNRTHLLACGTGAFQPTCALITVGH
  RGEHVLHLEPGSVESGRGRCPHEPSRPFASTFIDGELYTGLTADFLGREAMIFRSGGPRPALRSDSDQSLLHDPR
  FVMAARIPENSDQDNDKVYFFFSETVPSPDGGSNHVTVSRVGRVCVNDAGGQRVLVNKWSTFLKARLVCSVPGPG
  GAETHFDQLEDVFLLWPKAGKSLEVYALFSTVSAVFQGFAVCVYHMADIWEVFNGPFAHRDGPQHQWGPYGGKVP
  FPRPGVCPSKMTAQPGRPFGSTKDYPDEVLQFARAHPLMFWPVRPRHGRPVLVKTHLAQQLHQIVVDRVEAEDGT
  YDVIFLGTDSGSVLKVIALQAGGSAEPEEVVLEELQVFKVPTPITEMEISVKRQMLYVGSRLGVAQLRLHQCETY
  GTACAECCLARDPYCAWDGASCTHYRPSLGKRRFRRQDIRHGNPALQCLGQSQEEEAVGLVAATMVYGTEHNSTF
  LECLPKSPQAAVRWLLQRPGDEGPDQVKTDERVLHTERGLLFRRLSRFDAGTYTCTTLEHGFSQTVVRLALVVIV
  ASQLDNLFPPEPKPEEPPARGGLASTPPKAWYKDILQLIGFANLPRVDEYCERVWCRGTTECSGCFRSRSRGKQA
  RGKSWAGLELGKKMKSRVHAEHNRTPREVEAT

• Structural information:
  • Protein Domains: (32..51-)
    (/note="Sema-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00352-)
    (569..67-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013151  IPR016201   IPR001627  IPR036352  IPR027231  IPR015943  
  • Prosite: PS50835 PS51004
  • STRING: ENSP00000231721
• Other Databases: GeneCards:  SEMA3G  Malacards:  SEMA3G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071526	semaphorin-plexin signaling pathway	IBA	biological process
GO:0050919	negative chemotaxis	IBA	biological process
GO:0048843	negative regulation of axon extension involved in axon guidance	IBA	biological process
GO:0007411	axon guidance	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0001755	neural crest cell migration	IBA	biological process
GO:0045499	chemorepellent activity	IBA	molecular function
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0030215	semaphorin receptor binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0030215	semaphorin receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030517	negative regulation of axon extension	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005102	signaling receptor binding	ISS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0030517	negative regulation of axon extension	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq