• Gene id: 56910

Gene Summary

• Gene Symbol: STARD7   Gene   UCSC   Ensembl
• Aliases: FAME2, GTT1
• Gene name: StAR related lipid transfer domain containing 7
• Alternate names: stAR-related lipid transfer protein 7, mitochondrial, START domain containing 7, START domain-containing protein 7, StAR-related lipid transfer (START) domain containing 7, gestational trophoblastic tumor protein 1,
• Gene location: 2q11.2 (96208845: 96184858)     Exons: 8     NC_000002.12
• OMIM: 616712

Protein Summary

• Protein general information: Q9NQZ5  
  • Name: StAR related lipid transfer protein 7, mitochondrial (Gestational trophoblastic tumor protein 1) (START domain containing protein 7) (StARD7)
  • Length: 370  
  • Mass: 43113
  • Tissue specificity: Expressed in nasal epithelial cells. Down-regulated in nasal epithelial cells in patients experiencing an asthma exacerbation as compared to stable asthmatics and healthy controls. {ECO
• Sequence:

  MLPRRLLAAWLAGTRGGGLLALLANQCRFVTGLRVRRAQQIAQLYGRLYSESSRRVLLGRLWRRLHGRPGHASAL
  MAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHF
  KLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYS
  RDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPR
  YCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNEGSCGPARIEYA

• Structural information:
  • Protein Domains: (112..32-)
    (/note="START-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00197"-)
  • Interpro: IPR023393  IPR002913  IPR041949  
  • Prosite: PS50848
  • CDD: cd08911
  • STRING: ENSP00000338030
• Other Databases: GeneCards:  STARD7  Malacards:  STARD7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0006656	phosphatidylcholine biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0035745	T-helper 2 cell cytokine production	IEA	biological process
GO:0120197	mucociliary clearance	IEA	biological process
GO:0061436	establishment of skin barrier	IEA	biological process
GO:0042092	type 2 immune response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0001773	myeloid dendritic cell activation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)