• Gene id: 56834

Gene Summary

• Gene Symbol: GPR137   Gene   UCSC   Ensembl
• Aliases: C11orf4, GPR137A, TM7SF1L1
• Gene name: G protein-coupled receptor 137
• Alternate names: integral membrane protein GPR137, transmembrane 7 superfamily member 1-like 1 protein,
• Gene location: 11q13.1 (64270336: 64289499)     Exons: 12     NC_000011.10

Protein Summary

• Protein general information: Q96N19  
  • Name: Integral membrane protein GPR137 (Transmembrane 7 superfamily member 1 like 1 protein)
  • Length: 417  
  • Mass: 46059
• Sequence:

  MESNLSGLVPAAGLVPALPPAVTLGLTAAYTTLYALLFFSVYAQLWLVLLYGHKRLSYQTVFLALCLLWAALRTT
  LFSFYFRDTPRANRLGPLPFWLLYCCPVCLQFFTLTLMNLYFAQVVFKAKVKRRPEMSRGLLAVRGAFVGASLLF
  LLVNVLCAVLSHRRRAQPWALLLVRVLVSDSLFVICALSLAACLCLVARRAPSTSIYLEAKGTSVCQAAAMGGAM
  VLLYASRACYNLTALALAPQSRLDTFDYDWYNVSDQADLVNDLGNKGYLVFGLILFVWELLPTTLLVGFFRVHRP
  PQDLSTSHILNGQVFASRSYFFDRAGHCEDEGCSWEHSRGESTRCQDQAATTTVSTPPHRRDPPPSPTEYPGPSP
  PHPRPLCQVCLPLLAQDPGGRGYPLLWPAPCCSCHSELVPSP

• Structural information:
  • Interpro: IPR029723  
  • STRING: ENSP00000411827
• Other Databases: GeneCards:  GPR137  Malacards:  GPR137

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005765	lysosomal membrane	IBA	cellular component
GO:1904263	positive regulation of TORC1 signaling	IBA	biological process
GO:0045124	regulation of bone resorption	IBA	biological process
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray