• Gene id: 5678

Gene Summary

• Gene Symbol: PSG9   Gene   UCSC   Ensembl
• Aliases: PS34, PSBG-11, PSBG-9, PSG11, PSGII
• Gene name: pregnancy specific beta-1-glycoprotein 9
• Alternate names: pregnancy-specific beta-1-glycoprotein 9, PS-beta-B, PS-beta-G-11, PS-beta-G-9, pregnancy specific beta-1-glycoprotein 11, pregnancy-specific beta-1 glycoprotein B, pregnancy-specific beta-1-glycoprotein 11 C-R domain,
• Gene location: 19q13.31 (43269529: 43253281)     Exons: 7     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the pregnancy-specific glycoprotein (PSG) family. This protein family and the closely related carcinoembryonic antigen cell adhesion molecule (CEACAM) gene family are both members of the immunoglobulin super
• OMIM: 600836

Protein Summary

• Protein general information: Q00887  
  • Name: Pregnancy specific beta 1 glycoprotein 9 (PS beta G 9) (PSBG 9) (Pregnancy specific glycoprotein 9) (PS34) (Pregnancy specific beta 1 glycoprotein B) (PS beta B) (Pregnancy specific beta 1 glycoprotein 11) (PS beta G 11) (PSBG 11) (Pregnancy specific glyc
  • Length: 426  
  • Mass: 48272
• Sequence:

  MGPLPAPSCTQRITWKGLLLTASLLNFWNPPTTAEVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKGEMTDL
  YHYIISYIVDGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPY
  ISSSNLNPREAMEAVRLICDPETLDASYLWWMNGQSLPVTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSA
  SRSDPVTLNLLPKLPIPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPGVKRPIENRILILPSV
  TRNETGPYQCEIRDRYGGLRSNPVILNVLYGPDLPRIYPSFTYYRSGENLDLSCFTESNPPAEYFWTINGKFQQS
  GQKLFIPQITRNHSGLYACSVHNSATGKEISKSMTVKVSGPCHGDLTESQS

• Structural information:
  • Protein Domains: (35..14-)
    (/note="Ig-like-V-type)
    (147..23-)
    1 (/note="Ig-like-C2-type)
    (242..32-)
    2 (/note="Ig-like-C2-type)
    (335..41-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000270077
• Other Databases: GeneCards:  PSG9  Malacards:  PSG9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0007565	female pregnancy	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007565	female pregnancy	TAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq