• Gene id: 5675

Gene Summary

• Gene Symbol: PSG6   Gene   UCSC   Ensembl
• Aliases: PSBG-10, PSBG-12, PSBG-6, PSG10, PSGGB
• Gene name: pregnancy specific beta-1-glycoprotein 6
• Alternate names: pregnancy-specific beta-1-glycoprotein 6, PS-beta-G-10, PS-beta-G-12, PS-beta-G-6, pregnancy-specific beta-1-glycoprotein 10, pregnancy-specific beta-1-glycoprotein 12,
• Gene location: 19q13.31 (42917893: 42902085)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This gene is a member of the pregnancy-specific glycoprotein (PSG) gene family. The PSG genes are a subgroup of the carcinoembryonic antigen (CEA) family of immunoglobulin-like genes, and are found in a gene cluster at 19q13.1-q13.2 telomeric to another c
• OMIM: 614405

Protein Summary

• Protein general information: Q00889  
  • Name: Pregnancy specific beta 1 glycoprotein 6 (PS beta G 6) (PSBG 6) (Pregnancy specific glycoprotein 6) (Pregnancy specific beta 1 glycoprotein 10) (PS beta G 10) (PSBG 10) (Pregnancy specific glycoprotein 10) (Pregnancy specific beta 1 glycoprotein 12) (PS b
  • Length: 435  
  • Mass: 48814
• Sequence:

  MGPLSAPPCTQHITWKGLLLTASLLNFWNLPTTAQVIIEAKPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQMTDL
  YHYITSYVVHGQIIYGPAYSGRETVYSNASLLIQNVTQEDAGSYTLHIIKRGDGTGGVTGYFTVTLYSETPKPSI
  SSSNLNPREVMEAVRLICDPETPDASYLWLLNGQNLPMTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSAS
  RSDPVTLNLLPKLPMPYITINNLNPREKKDVLAFTCEPKSRNYTYIWWLNGQSLPVSPRVKRPIENRILILPSVT
  RNETGPYQCEIRDRYGGIRSNPVTLNVLYGPDLPRIYPSFTYYRSGENLDLSCFADSNPPAEYSWTINGKFQLSG
  QKLFIPQITTNHSGLYACSVRNSATGKEISKSMIVKVSETASPQVTYAGPNTWFQEILLL

• Structural information:
  • Protein Domains: (35..14-)
    (/note="Ig-like-V-type)
    (148..23-)
    1 (/note="Ig-like-C2-type)
    (241..32-)
    2 (/note="Ig-like-C2-type)
    (334..40-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000292125
• Other Databases: GeneCards:  PSG6  Malacards:  PSG6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0007565	female pregnancy	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007565	female pregnancy	NAS	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005576	extracellular region	NAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq