• Gene id: 56731

Gene Summary

• Gene Symbol: SLC2A4RG   Gene   UCSC   Ensembl
• Aliases: GEF, HDBP-1, HDBP1, Si-1-2, Si-1-2-19
• Gene name: SLC2A4 regulator
• Alternate names: SLC2A4 regulator, GLUT4 enhancer factor, Huntington's disease gene regulatory region-binding protein 1,
• Gene location: 20q13.33 (63739775: 63744049)     Exons: 8     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcripti
• OMIM: 606178

Protein Summary

• Protein general information: Q9NR83  
  • Name: SLC2A4 regulator (GLUT4 enhancer factor) (GEF) (Huntington disease gene regulatory region binding protein 1) (HDBP 1)
  • Length: 387  
  • Mass: 41267
  • Tissue specificity: According to PubMed
• Sequence:

  MERPPPRAAGRDPSALRAEAPWLRAEGPGPRAAPVTVPTPPQGSSVGGGFAGLEFARPQESEPRASDLGAPRTWT
  GAAAGPRTPSAHIPVPAQRATPGKARLDEVMAAAALTSLSTSPLLLGAPVAAFSPEPGLEPWKEALVRPPGSYSS
  SSNSGDWGWDLASDQSSPSTPSPPLPPEAAHFLFGEPTLRKRKSPAQVMFQCLWKSCGKVLSTASAMQRHIRLVH
  LGRQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPTASMPPAFPRLELPELLEPPALPSPLRPPAPPLPP
  PPVLSTVANPQSCHSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKPRGDAKKCRKVYGMERRDLWCTA
  CRWKKACQRFLD

• Structural information:
  • Interpro: IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000266077
• Other Databases: GeneCards:  SLC2A4RG  Malacards:  SLC2A4RG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0005634	nucleus	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881