Search Result
| Gene id | 5673 | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||
| Gene Symbol | PSG5 Gene UCSC Ensembl | ||||||||||||||||||||
| Aliases | FL-NCA-3, PSG | ||||||||||||||||||||
| Gene name | pregnancy specific beta-1-glycoprotein 5 | ||||||||||||||||||||
| Alternate names | pregnancy-specific beta-1-glycoprotein 5, PS-beta-G-5, PSBG-5, Pregnancy-specific beta-1-glycoprotein-5, fetal liver non-specific cross-reactive antigen 3, pregnancy-specific beta 1 glycoprotein, pregnancy-specific glycoprotein 5, | ||||||||||||||||||||
| Gene location |
19q13.31 (43186535: 43167742) Exons: 7 NC_000019.10 |
||||||||||||||||||||
| Gene summary(Entrez) |
The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunog |
||||||||||||||||||||
| OMIM | 611821 | ||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||
| Protein general information | Q15238 Name: Pregnancy specific beta 1 glycoprotein 5 (PS beta G 5) (PSBG 5) (Pregnancy specific glycoprotein 5) (Fetal liver non specific cross reactive antigen 3) (FL NCA 3) Length: 335 Mass: 37713 Tissue specificity: Synthesized by syncytiotrophoblast of the placenta. | ||||||||||||||||||||
| Sequence |
MGPLSAPPCTQHITWKGLLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQLMDL YHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTFNLYLKLPKPY ITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYECEIRDRDGG MRSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQQSGQKLSIPQITTKHRGLYT CSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI | ||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||
| Other Databases | GeneCards: PSG5  Malacards: PSG5 | ||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||
| |||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||
| |||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||
| |||||||||||||||||||||