Search Result
| Gene id | 5669 | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | PSG1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||
| Aliases | B1G1, CD66f, DHFRP2, FL-NCA-1/2, PBG1, PS-beta-C/D, PS-beta-G-1, PSBG-1, PSBG1, PSG95, PSGGA, PSGIIA, SP1 | ||||||||||||||||||||||||||||||||||||||||
| Gene name | pregnancy specific beta-1-glycoprotein 1 | ||||||||||||||||||||||||||||||||||||||||
| Alternate names | pregnancy-specific beta-1-glycoprotein 1, CD66 antigen-like family member F, fetal liver non-specific cross-reactive antigen 1/2, pregnancy-specific B-1 glycoprotein, pregnancy-specific beta-1 glycoprotein C/D, | ||||||||||||||||||||||||||||||||||||||||
| Gene location |
19q13.2 (42879821: 42866460) Exons: 7 NC_000019.10 |
||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The human placenta is a multihormonal endocrine organ that produces hormones, enzymes, and other molecules that support fetal survival and development. Pregnancy-specific beta-1-glycoprotein (PSBG, PSG) is a major product of the syncytiotrophoblast, reach |
||||||||||||||||||||||||||||||||||||||||
| OMIM | 176390 | ||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||
| Protein general information | P11464 Name: Pregnancy specific beta 1 glycoprotein 1 (PS beta G 1) (PSBG 1) (Pregnancy specific glycoprotein 1) (CD66 antigen like family member F) (Fetal liver non specific cross reactive antigen 1/2) (FL NCA 1/2) (PSG95) (Pregnancy specific beta 1 glycoprotein C/D) Length: 419 Mass: 47,223 | ||||||||||||||||||||||||||||||||||||||||
| Sequence |
MGTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAQVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQMRDL YHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLETPKPS ISSSNLNPRETMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLKLSETNRTLFLLGVTKYTAGPYECEIRNPVSA SRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSV TRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLP GQKLFIRHITTKHSGLYVCSVRNSATGKESSKSMTVEVSDWTVP | ||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: PSG1  Malacards: PSG1 | ||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||