Search Result
| Gene id | 56683 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | CFAP298 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | C21orf48, C21orf59, CILD26, FBB18, Kur | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | cilia and flagella associated protein 298 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | cilia- and flagella-associated protein 298, UPF0769 protein C21orf59, kurly homolog, prostate cancer upregulated protein 1, protein kurly homolog, | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
21q22.11 (31391674: 31538210) Exons: 16 NC_000017.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-c |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 615494 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SNPs |
rs202094637 Strand: Allele origin: Allele change: Mutation type: snv NC_000021.9 g.32602299G>A NC_000021.9 g.32602299G>C NC_000021.8 g.33974609G>A NC_000021.8 g.33974609G>C NG_033839.2 g.15310C>T NG_033839.2 g.15310C>G NM_021254.4 c.735C>T NM_021254.4 c.735C>G NM_021254.3 c.735C>T NM_021254.3 c.735C>G NM_021254.2 c.73 rs143740376 Strand: Allele origin: Allele change: Mutation type: snv NC_000021.9 g.32609853G>A NC_000021.8 g.33982163G>A NG_033839.2 g.7756C>T NM_021254.4 c.292C>T NM_021254.3 c.292C>T NM_021254.2 c.292C>T NM_001350334.2 c.63C>T NM_001350334.1 c.63C>T NM_001350336.2 c.292C>T NM_001350336.1 c.292C>T NM_001350337.2 c.29 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | P57076 Name: Cilia and flagella associated protein 298 (Protein kurly homolog) Length: 290 Mass: 33224 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKL KDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAV MIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQ GAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFHGVKDIKWRPR | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: CFAP298  Malacards: CFAP298 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||