• Gene id: 56666

Gene Summary

• Gene Symbol: PANX2   Gene   UCSC   Ensembl
• Aliases: PX2, hPANX2
• Gene name: pannexin 2
• Alternate names: pannexin-2,
• Gene location: 22q13.33 (50170730: 50180294)     Exons: 4     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nervous system (CNS) and are coexpressed in various neur

Protein Summary

• Protein general information: Q96RD6  
  • Name: Pannexin 2
  • Length: 677  
  • Mass: 74447
• Sequence:

  MHHLLEQSADMATALLAGEKLRELILPGAQDDKAGALAALLLQLKLELPFDRVVTIGTVLVPILLVTLVFTKNFA
  EEPIYCYTPHNFTRDQALYARGYCWTELRDALPGVDASLWPSLFEHKFLPYALLAFAAIMYVPALGWEFLASTRL
  TSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITEREKREIIENAEKEKSPEQNLFEKYLERRGRSNFLAK
  LYLARHVLILLLSAVPISYLCTYYATQKQNEFTCALGASPDGAAGAGPAVRVSCKLPSVQLQRIIAGVDIVLLCV
  MNLIILVNLIHLFIFRKSNFIFDKLHKVGIKTRRQWRRSQFCDINILAMFCNENRDHIKSLNRLDFITNESDLMY
  DNVVRQLLAALAQSNHDATPTVRDSGVQTVDPSANPAEPDGAAEPPVVKRPRKKMKWIPTSNPLPQPFKEPLAIM
  RVENSKAEKPKPARRKTATDTLIAPLLDRSAHHYKGGGGDPGPGPAPAPAPPPAPDKKHARHFSLDVHPYILGTK
  KAKAEAVPAALPASRSQEGGFLSQAEDCGLGLAPAPIKDAPLPEKEIPYPTEPARAGLPSGGPFHVRSPPAAPAV
  APLTPASLGKAEPLTILSRNATHPLLHINTLYEAREEEDGGPRLPQDVGDLIAIPAPQQILIATFDEPRTVVSTV
  EF

• Structural information:
  • Interpro: IPR000990  IPR039099  
  • Prosite: PS51013
  • STRING: ENSP00000379183
• Other Databases: GeneCards:  PANX2  Malacards:  PANX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022829	wide pore channel activity	IBA	molecular function
GO:0007267	cell-cell signaling	IBA	biological process
GO:0006812	cation transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006812	cation transport	IEA	biological process
GO:0015267	channel activity	IEA	molecular function
GO:0050716	positive regulation of interleukin-1 secretion	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005921	gap junction	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015267	channel activity	IEA	molecular function
GO:0002931	response to ischemia	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005921	gap junction	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005198	structural molecule activity	ISS	molecular function
GO:0055077	gap junction hemi-channel activity	ISS	NOT|molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq