• Gene id: 56659

Gene Summary

• Gene Symbol: KCNK13   Gene   UCSC   Ensembl
• Aliases: K2p13.1, THIK-1, THIK1
• Gene name: potassium two pore domain channel subfamily K member 13
• Alternate names: potassium channel subfamily K member 13, K2P13.1 potassium channel, potassium channel, subfamily K, member 13, potassium channel, two pore domain subfamily K, member 13, tandem pore domain halothane-inhibited potassium channel 1, tandem pore domain potassium c,
• Gene location: 14q32.11 (90061993: 90185852)     Exons: 2     NC_000014.9
• Gene summary(Entrez): Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, e

Protein Summary

• Protein general information: Q9HB14  
  • Name: Potassium channel subfamily K member 13 (Tandem pore domain halothane inhibited potassium channel 1) (THIK 1)
  • Length: 408  
  • Mass: 45391
• Sequence:

  MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDELRGFL
  RHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCSSTILFFNLFLERLI
  TIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYF
  DSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCP
  QCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASLAILQKQLSEMANGCP
  HQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR

• Structural information:
  • Interpro: IPR003280  IPR005410  IPR013099  
  • STRING: ENSP00000282146
• Other Databases: GeneCards:  KCNK13  Malacards:  KCNK13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005267	potassium channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq