Search Result
| Gene id | 5655 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | KLK10 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | NES1, PRSSL1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | kallikrein related peptidase 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | kallikrein-10, breast normal epithelial cell associated serine protease, kallikrein 10 protein 1, kallikrein 10 protein 12, kallikrein 10 protein 13, kallikrein 10 protein 2, kallikrein 10 protein 3, kallikrein 10 protein 4, kallikrein 10 protein 5, kallikrein 10 , | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
19q13.41 (51020174: 51012738) Exons: 9 NC_000019.10 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one |
||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | O43240 Name: Kallikrein 10 (EC 3.4.21. ) (Normal epithelial cell specific 1) (Protease serine like 1) Length: 276 Mass: 30170 Tissue specificity: Expressed in breast, ovary and prostate. | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVL VDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLG PRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPC QSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: KLK10  Malacards: KLK10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||