• Gene id: 56413

Gene Summary

• Gene Symbol: LTB4R2   Gene   UCSC   Ensembl
• Aliases: BLT2, BLTR2, JULF2, KPG_004, LTB4-R 2, LTB4-R2, NOP9
• Gene name: leukotriene B4 receptor 2
• Alternate names: leukotriene B4 receptor 2, LTB4 receptor JULF2, leukotriene B4 receptor BLT2, seven transmembrane receptor BLTR2,
• Gene location: 14q12 (24310139: 24312052)     Exons: 2     NC_000014.9
• OMIM: 615521

Protein Summary

• Protein general information: Q9NPC1  
  • Name: Leukotriene B4 receptor 2 (LTB4 R 2) (LTB4 R2) (LTB4 receptor JULF2) (Leukotriene B4 receptor BLT2) (Seven transmembrane receptor BLTR2)
  • Length: 358  
  • Mass: 37942
  • Tissue specificity: Widely expressed.
• Sequence:

  MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLT
  PLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAAL
  LLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRL
  VSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
  PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR003981  IPR003982  
  • Prosite: PS50262
  • STRING: ENSP00000445772
• Other Databases: GeneCards:  LTB4R2  Malacards:  LTB4R2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0001632	leukotriene B4 receptor activity	IBA	molecular function
GO:0004966	galanin receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0004974	leukotriene receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004974	leukotriene receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0007194	negative regulation of adenylate cyclase activity	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0051546	keratinocyte migration	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0001632	leukotriene B4 receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0061737	leukotriene signaling pathway	IEA	biological process
GO:0061737	leukotriene signaling pathway	IEA	biological process
GO:0061737	leukotriene signaling pathway	IEA	biological process
GO:0061737	leukotriene signaling pathway	IEA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881