• Gene id: 56265

Gene Summary

• Gene Symbol: CPXM1   Gene   UCSC   Ensembl
• Aliases: CPX1, CPXM
• Gene name: carboxypeptidase X, M14 family member 1
• Alternate names: probable carboxypeptidase X1, carboxypeptidase X (M14 family), member 1, carboxypeptidase-like protein X1, metallocarboxypeptidase CPX-1,
• Gene location: 20p13 (20016822: 19966726)     Exons: 27     NC_000022.11
• Gene summary(Entrez): This gene likely encodes a member of the carboxypeptidase family of proteins. Cloning of a comparable locus in mouse indicates that the encoded protein contains a discoidin domain and a carboxypeptidase domain, but the protein appears to lack residues nec
• OMIM: 609555

Protein Summary

• Protein general information: Q96SM3  
  • Name: Probable carboxypeptidase X1 (EC 3.4.17. ) (Metallocarboxypeptidase CPX 1)
  • Length: 734  
  • Mass: 81668
• Sequence:

  MWGLLLALAAFAPAVGPALGAPRNSVLGLAQPGTTKVPGSTPALHSSPAQPPAETANGTSEQHVRIRVIKKKKVI
  MKKRKKLTLTRPTPLVTAGPLVTPTPAGTLDPAEKQETGCPPLGLESLRVSDSRLEASSSQSFGLGPHRGRLNIQ
  SGLEDGDLYDGAWCAEEQDADPWFQVDAGHPTRFSGVITQGRNSVWRYDWVTSYKVQFSNDSRTWWGSRNHSSGM
  DAVFPANSDPETPVLNLLPEPQVARFIRLLPQTWLQGGAPCLRAEILACPVSDPNDLFLEAPASGSSDPLDFQHH
  NYKAMRKLMKQVQEQCPNITRIYSIGKSYQGLKLYVMEMSDKPGEHELGEPEVRYVAGMHGNEALGRELLLLLMQ
  FLCHEFLRGNPRVTRLLSEMRIHLLPSMNPDGYEIAYHRGSELVGWAEGRWNNQSIDLNHNFADLNTPLWEAQDD
  GKVPHIVPNHHLPLPTYYTLPNATVAPETRAVIKWMKRIPFVLSANLHGGELVVSYPFDMTRTPWAARELTPTPD
  DAVFRWLSTVYAGSNLAMQDTSRRPCHSQDFSVHGNIINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHE
  NELPQEWENNKDALLTYLEQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGDYWRLLTPGDYMVTASA
  EGYHSVTRNCRVTFEEGPFPCNFVLTKTPKQRLRELLAAGAKVPPDLRRRLERLRGQKD

• Structural information:
  • Protein Domains: (113..27-)
    C (/note="F5/8-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00081"-)
  • Interpro: IPR008969  IPR000421  IPR008979  IPR000834  
  • Prosite: PS00132 PS00133 PS50022
  • CDD: cd00057
  • STRING: ENSP00000369979
• Other Databases: GeneCards:  CPXM1  Malacards:  CPXM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016485	protein processing	IBA	biological process
GO:0006518	peptide metabolic process	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004181	metallocarboxypeptidase activity	IBA	molecular function
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray