• Gene id: 56241

Gene Summary

• Gene Symbol: SUSD2   Gene   UCSC   Ensembl
• Aliases: BK65A6.2, W5C5
• Gene name: sushi domain containing 2
• Alternate names: sushi domain-containing protein 2, Sushi domain (SCR repeat) containing, testicular tissue protein Li 190,
• Gene location: 22q11.23 (24181486: 24189105)     Exons: 15     NC_000022.11
• OMIM: 607959

Protein Summary

• Protein general information: Q9UGT4  
  • Name: Sushi domain containing protein 2
  • Length: 822  
  • Mass: 90208
  • Tissue specificity: Highly expressed in breast cancer, but shows a restricted expression pattern in normal tissues such as adipose, adrenal gland, kidney, lung, mammary gland, placenta, thyroid, trachea, and uterus (PubMed
• Sequence:

  MKPALLPWALLLLATALGPGPGPTADAQESCSMRCGALDGPCSCHPTCSGLGTCCLDFRDFCLEILPYSGSMMGG
  KDFVVRHFKMSSPTDASVICRFKDSIQTLGHVDSSGQVHCVSPLLYESGRIPFTVSLDNGHSFPRAGTWLAVHPN
  KVSMMEKSELVNETRWQYYGTANTSGNLSLTWHVKSLPTQTITIELWGYEETGMPYSQEWTAKWSYLYPLATHIP
  NSGSFTFTPKPAPPSYQRWRVGALRIIDSKNYAGQKDVQALWTNDHALAWHLSDDFREDPVAWARTQCQAWEELE
  DQLPNFLEELPDCPCTLTQARADSGRFFTDYGCDMEQGSVCTYHPGAVHCVRSVQASLRYGSGQQCCYTADGTQL
  LTADSSGGSTPDRGHDWGAPPFRTPPRVPSMSHWLYDVLSFYYCCLWAPDCPRYMQRRPSNDCRNYRPPRLASAF
  GDPHFVTFDGTNFTFNGRGEYVLLEAALTDLRVQARAQPGTMSNGTETRGTGLTAVAVQEGNSDVVEVRLANRTG
  GLEVLLNQEVLSFTEQSWMDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLN
  NDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSL
  AQEAAKLCGDDHFCNFDVAATGSLSTGTATRVAHQLHQRRMQSLQPVVSCGWLAPPPNGQKEGNRYLAGSTIYFH
  CDNGYSLAGAETSTCQADGTWSSPTPKCQPGRSYAVLLGIIFGGLAVVAAVALVYVLLRRRKGNTHVWGAQP

• Structural information:
  • Protein Domains: (28..6-)
    (/note="SMB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00350-)
    (285..43-)
    (/note="AMOP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00347-)
    (446..66-)
    (/note="VWFD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00580-)
    (72-)
  • Interpro: IPR005533  IPR036024  IPR001212  IPR035976  IPR000436   IPR001846  
  • Prosite: PS50856 PS00524 PS50958 PS50923 PS51233
  • CDD: cd00033
  • STRING: ENSP00000351075
• Other Databases: GeneCards:  SUSD2  Malacards:  SUSD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051782	negative regulation of cell division	IDA	biological process
GO:1902807	negative regulation of cell cycle G1/S phase transition	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq