• Gene id: 56157

Gene Summary

• Gene Symbol: TEX13A   Gene   UCSC   Ensembl
• Gene name: testis expressed 13A
• Alternate names: testis-expressed protein 13A, testis-expressed sequence 13A protein,
• Gene location: Xq22.3 (105220693: 105218928)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene is similar to a mouse gene that is expressed in the testis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
• OMIM: 300312

Protein Summary

• Protein general information: Q9BXU3  
  • Name: Testis expressed protein 13A
  • Length: 409  
  • Mass: 45583
  • Tissue specificity: Testis specific.
• Sequence:

  MALRPEDPSSGFRHSNVVAFINEKMARHTKGPEFYLENISLSWEKVEDKLRAILEDSEVPSEVKEACTWGSLALG
  VRFAHRQAQLQRHRVRWLHGFAKLHKSAAQALASDLKKLREQQETERKEAASRLRMAQTSLVEVQKERDKELVSP
  HEWEQGAGWPGLATAGGVCTEGAAEEEEEAAVAAAGAAGGKGAEEEQRDVEVVAAPVEAMAPPVEAGAAPMETQF
  PHVEARAASMETTEKLERILLQLLGDADQEKYTYWGQKEGDLRSVETATSYFSGTTNPWSRASSEPLPVQLPASY
  SYSYSSPFSSFSDIPTISPPQATVTAPVPPQLPSDWEAFDTSLWSDGGPHRIDHQEHPRDRRYSEPHQQRPPVYR
  RPGDWDCPWCNAVNFSRRDTCFDCGKGIWLQKPH

• Structural information:
  • Interpro: IPR028193  IPR001876  IPR036443  
  • Prosite: PS01358 PS50199
  • STRING: ENSP00000471604
• Other Databases: GeneCards:  TEX13A  Malacards:  TEX13A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)