• Gene id: 56156

Gene Summary

• Gene Symbol: TEX13B   Gene   UCSC   Ensembl
• Aliases: TGC3B, TSGA5
• Gene name: testis expressed 13B
• Alternate names: testis-expressed protein 13B, testis expressed sequence 13B, testis-expressed sequence 13B protein,
• Gene location: Xq22.3 (107982369: 107980863)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene is similar to a mouse gene that is expressed in the testis. [provided by RefSeq, Jul 2008]
• OMIM: 612610

Protein Summary

• Protein general information: Q9BXU2  
  • Name: Testis expressed protein 13B
  • Length: 312  
  • Mass: 33967
  • Tissue specificity: Testis specific.
• Sequence:

  MALRPEDPSSGFRHGNVVAFIIEKMARHTKGPEFYFENISLSWEEVEDKLRAILEDSEVPSEVKEACTWGSLALG
  VRFAHRQGQLQNRRVQWLQGFAKLHRSAALVLASNLTELKEQQEMECNEATFQLQLTETSLAEVQRERDMLRWKL
  FHAELAPPQGQGQATVFPGLATAGGDWTEGAGEQEKEAVAAAGAAGGKGEERYAEAGPAPAEVLQGLGGGFRQPL
  GAIVAGKLHLCGAEGERSQVSTNSHVCLLWAWVHSLTGASSCPAPYLIHILIPMPFVRLLSHTQYTPFTSKGHRT
  GSNSDAFQLGGL

• Structural information:
  • Interpro: IPR028193  
  • STRING: ENSP00000303777
• Other Databases: GeneCards:  TEX13B  Malacards:  TEX13B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881