• Gene id: 55909

Gene Summary

• Gene Symbol: BIN3   Gene   UCSC   Ensembl
• Gene name: bridging integrator 3
• Alternate names: bridging integrator 3,
• Gene location: 8p21.3 (22669147: 22620417)     Exons: 12     NC_000008.11
• Gene summary(Entrez): The product of this gene is a member of the BAR domain protein family. The encoded protein is comprised solely of a BAR domain which is predicted to form coiled-coil structures and proposed to mediate dimerization, sense and induce membrane curvature, and
• OMIM: 602652

Protein Summary

• Protein general information: Q9NQY0  
  • Name: Bridging integrator 3
  • Length: 253  
  • Mass: 29665
  • Tissue specificity: Ubiquitously expressed except in brain. {ECO
• Sequence:

  MSWIPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLLSNPLCEQD
  QDLLNMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPSLNMAVKRREQALQDYRRLQAKVEKYEEKEK
  TGPVLAKLHQAREELRPVREDFEAKNRQLLEEMPRFYGSRLDYFQPSFESLIRAQVVYYSEMHKIFGDLSHQLDQ
  PGHSDEQRERENEAKLSELRALSIVADD

• Structural information:
  • Protein Domains: (9..23-)
    (/note="BAR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00361"-)
  • Interpro: IPR027267  IPR004148  IPR037428  
  • Prosite: PS51021
  • CDD: cd07590
  • STRING: ENSP00000276416
• Other Databases: GeneCards:  BIN3  Malacards:  BIN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IBA	contributes to
GO:0008092	cytoskeletal protein binding	IBA	molecular function
GO:0097320	plasma membrane tubulation	IBA	biological process
GO:0051666	actin cortical patch localization	IBA	biological process
GO:0006897	endocytosis	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0000917	division septum assembly	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014839	myoblast migration involved in skeletal muscle regeneration	IEA	biological process
GO:0005884	actin filament	IEA	cellular component
GO:0048741	skeletal muscle fiber development	IEA	biological process
GO:0043403	skeletal muscle tissue regeneration	IEA	biological process
GO:0010591	regulation of lamellipodium assembly	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0009826	unidimensional cell growth	IMP	biological process
GO:0008104	protein localization	IMP	biological process
GO:0008093	cytoskeletal anchor activity	NAS	molecular function
GO:0007015	actin filament organization	NAS	biological process
GO:0061640	cytoskeleton-dependent cytokinesis	NAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R