|
Gene id |
55891 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
LENEP Gene UCSC Ensembl |
|
Aliases |
LEP503 |
|
Gene name |
lens epithelial protein |
|
Alternate names |
lens epithelial cell protein LEP503, |
|
Gene location |
1q21.3 (127588410: 127591699) Exons: 6 NC_000007.14
|
|
Gene summary(Entrez) |
The ocular lens is a tissue of epithelial origin and devoid of blood vessels and nerves. Cells of the lens epithelium are responsible for the growth and maintenance of the lens through mitosis, protein synthesis, and active transport of ions and metabolit
|
|
OMIM |
607377 |
Protein Summary
|
| Protein general information
| Q9Y5L5
Name: Lens epithelial cell protein LEP503
Length: 61 Mass: 6908
Tissue specificity: Restricted to lens epithelial cells. {ECO
|
| Sequence |
MQPRTQPLAQTLPFFLGGAPRDTGLRVPVIKMGTGWEGFQRTLKEVAYILLCCWCIKELLD
|
| Structural information |
|
| Other Databases |
GeneCards: LENEP  Malacards: LENEP |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0007275 |
multicellular organism de velopment
|
IEA |
biological process |
GO:0003677 |
DNA binding
|
TAS |
molecular function |
GO:0007275 |
multicellular organism de velopment
|
TAS |
biological process |
GO:0005515 |
protein binding
|
IPI |
molecular function |
|
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|