• Gene id: 55884

Gene Summary

• Gene Symbol: WSB2   Gene   UCSC   Ensembl
• Aliases: SBA2
• Gene name: WD repeat and SOCS box containing 2
• Alternate names: WD repeat and SOCS box-containing protein 2, CS box-containing WD protein, WSB-2,
• Gene location: 12q24.23 (2096663: 2071035)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the WD-protein subfamily. The encoded protein contains five WD-repeats spanning most of the protein and an SOCS box in the C-terminus. The SOCS box may act as a bridge between specific substrate-binding domains and E3 ubiquit

Protein Summary

• Protein general information: Q9NYS7  
  • Name: WD repeat and SOCS box containing protein 2 (WSB 2) (CS box containing WD protein)
  • Length: 404  
  • Mass: 45286
• Sequence:

  MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKN
  ETKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEVQTGLLLLNLS
  GHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLWS
  MRSYTLIRKLEGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMDDSDVHISSLRSVC
  FSPEGLYLATVADDRLLRIWALELKTPIAFAPMTNGLCCTFFPHGGVIATGTRDGHVQFWTAPRVLSSLKHLCRK
  ALRSFLTTYQVLALPIPKKMKEFLTYRTF

• Structural information:
  • Protein Domains: (356..40-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR020472  IPR001496  IPR036036  IPR015943  IPR001680   IPR019775  IPR017986  IPR036322  
  • Prosite: PS50225 PS00678 PS50082 PS50294
  • STRING: ENSP00000409131
• Other Databases: GeneCards:  WSB2  Malacards:  WSB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)