• Gene id: 55861

Gene Summary

• Gene Symbol: DBNDD2   Gene   UCSC   Ensembl
• Aliases: C20orf35, CK1BP, HSMNP1
• Gene name: dysbindin domain containing 2
• Alternate names: dysbindin domain-containing protein 2, SCF apoptosis response protein 1, casein kinase-1 binding protein, dysbindin (dystrobrevin binding protein 1) domain containing 2,
• Gene location: 20q13.12 (45405992: 45410614)     Exons: 5     NC_000020.11

Protein Summary

• Protein general information: Q9BQY9  
  • Name: Dysbindin domain containing protein 2 (Casein kinase 1 binding protein) (CK1BP) (HSMNP1)
  • Length: 259  
  • Mass: 27671
  • Tissue specificity: Detected in brain. {ECO
• Sequence:

  MGAGNFLTALEVPVAALAGAASDRRASCERVSPPPPLPHFRLPPLPRSRLPGPVSRPEPGAPLLGCWLQWGAPSP
  GPLCLLFRLCSCTCFAPLPAGADMDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSI
  SSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNL
  HSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS

• Structural information:
  • Interpro: IPR007531  
  • STRING: ENSP00000361795
• Other Databases: GeneCards:  DBNDD2  Malacards:  DBNDD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881