• Gene id: 55854

Gene Summary

• Gene Symbol: ZC3H15   Gene   UCSC   Ensembl
• Aliases: HT010, LEREPO4, MSTP012
• Gene name: zinc finger CCCH-type containing 15
• Alternate names: zinc finger CCCH domain-containing protein 15, DRG family-regulatory protein 1, likely ortholog of mouse immediate early response erythropoietin 4,
• Gene location: 2q32.1 (186486252: 186509360)     Exons: 10     NC_000002.12

Protein Summary

• Protein general information: Q8WU90  
  • Name: Zinc finger CCCH domain containing protein 15 (DRG family regulatory protein 1) (Likely ortholog of mouse immediate early response erythropoietin 4)
  • Length: 426  
  • Mass: 48602
• Sequence:

  MPPKKQAQAGGSKKAEQKKKEKIIEDKTFGLKNKKGAKQQKFIKAVTHQVKFGQQNPRQVAQSEAEKKLKKDDKK
  KELQELNELFKPVVAAQKISKGADPKSVVCAFFKQGQCTKGDKCKFSHDLTLERKCEKRSVYIDARDEELEKDTM
  DNWDEKKLEEVVNKKHGEAEKKKPKTQIVCKHFLEAIENNKYGWFWVCPGGGDICMYRHALPPGFVLKKDKKKEE
  KEDEISLEDLIERERSALGPNVTKITLESFLAWKKRKRQEKIDKLEQDMERRKADFKAGKALVISGREVFEFRPE
  LVNDDDEEADDTRYTQGTGGDEVDDSVSVNDIDLSLYIPRDVDETGITVASLERFSTYTSDKDENKLSEASGGRA
  ENGERSDLEEDNEREGTENGAIDAVPVDENLFTGEDLDELEEELNTLDLEE

• Structural information:
  • Interpro: IPR032378  IPR041367  IPR000571  IPR036855  
  • Prosite: PS50103
  • STRING: ENSP00000338788
• Other Databases: GeneCards:  ZC3H15  Malacards:  ZC3H15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0002181	cytoplasmic translation	IBA	biological process
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881