• Gene id: 55843

Gene Summary

• Gene Symbol: ARHGAP15   Gene   UCSC   Ensembl
• Aliases: BM046
• Gene name: Rho GTPase activating protein 15
• Alternate names: rho GTPase-activating protein 15, rho-type GTPase-activating protein 15,
• Gene location: 2q22.2-q22.3 (143070972: 143768351)     Exons: 23     NC_000002.12
• Gene summary(Entrez): RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).[supplied by OMIM, Mar 2008]
• OMIM: 300777

Protein Summary

• Protein general information: Q53QZ3  
  • Name: Rho GTPase activating protein 15 (ArhGAP15) (Rho type GTPase activating protein 15)
  • Length: 475  
  • Mass: 54544
  • Tissue specificity: Expressed in lung, liver and lymphoid cells. {ECO
• Sequence:

  MQKSTNSDTSVETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHRRNHSQHILKDVIPPL
  EQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRRIEFYKESKQQALSNMKTGHKPESVDLCGAHIEWAKEK
  SSRKNVFQITTVSGNEFLLQSDIDFIILDWFHAIKNAIDRLPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKE
  QKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
  CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYSFFEQF
  VEAIKKQDNNTRIEAVKSLVQKLPPPNRDTMKVLFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAENETGNMAI
  HMVYQNQIAELMLSEYSKIFGSEED

• Structural information:
  • Protein Domains: (79..18-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (281..47-)
    (/note="Rho-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00172"-)
  • Interpro: IPR011993  IPR001849  IPR008936  IPR000198  
  • Prosite: PS50003 PS50238
  • PDB: 3BYI
  • PDBsum: 3BYI
  • STRING: ENSP00000295095
• Other Databases: GeneCards:  ARHGAP15  Malacards:  ARHGAP15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043087	regulation of GTPase activity	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008360	regulation of cell shape	IDA	biological process
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R